KEGG   Zea mays (maize): 100383306Help
Entry
100383306         CDS       T01088                                 

Definition
uncharacterized LOC100383306
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100383306
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100383306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 601 aa AA seqDB search
MLVYIRESDKEKIMCNVDEKDIAEHLRIRLKKEQEEKEHKKKEKAEAHLYTIIKIARDED
LKEQIGKNIYFDLVDHEKVHSFRIQKQLPFTSFKEEVAKEFGIPVQFQRFWLWAKRQNHT
YRPNRPLTPHEEAQSVGQLREVSNKAHNAELKLFLEVELGPELCPIRPPEKSKEDILLFF
KLYNAEKEELHFVGRLFVKALGKPSEILTKLNAMAGFSPNEEIELYEEIKFEPNVMCEHI
DKKLTFRSSQLEDGDIICFQKAPVPDGDAQVRYPDVPSFLEYVHNRQVVHFRCLDKPKDD
DFSLELSKLHTYDDVVERVAHQLGLDDPSKIRLTSHNCYSQQPKPQPIRYRGVAHLLDML
VHYNQTSDILYYEVLDIPLPDLQRLKTLKVAFHHATKDEVVVHSIRLPRNSTISDVITDL
KTKVELSNPDAELRLLEVFYHKIYKIFPPHEKIENINDQYWTLRAEEIPEEEKNLGPHDR
LIHVYHFMKDPNQNQQIQNFGDPFLMVIREGETAAEVMERIQRKLRVPDDEFSKWKLAFI
SMNRPEYLQDTDVVSARFQRRDVYGAWEQYLGLEHTDTTSKRSYTSNQNRHTYEKPVKIY
N
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtctatatacgtgagagtgacaaagagaaaataatgtgtaatgtcgatgagaag
gacatcgctgagcatttgcggataaggttgaagaaagaacaagaagagaaagaacacaag
aagaaggagaaggctgaagctcatctctacactatcataaagatcgctcgagacgaggac
ttaaaggagcaaatcggtaagaatatatattttgatctggtggaccatgaaaaagttcac
agtttccgcattcagaagcagttgccttttacttcattcaaggaggaagttgcaaaggaa
tttggcatccctgtacagtttcagcgcttctggttgtgggctaagaggcagaaccataca
taccggcccaatcgtccattgacaccccatgaggaagcacaatcagtcgggcagcttagg
gaagtctcaaataaggcacacaatgctgagctgaagctgtttctggaagttgaacttgga
ccggagttatgtccaattcgtccacctgagaagagcaaagaagacatacttcttttcttc
aagctttataatgctgagaaggaagagcttcattttgttggtaggctttttgtgaaggct
ctgggaaagccatctgaaatattgacaaaactgaatgcaatggctggattttctccaaat
gaagaaattgagctgtacgaggaaattaagtttgagccaaatgtgatgtgcgaacatatt
gacaagaaacttactttccgctctagtcagcttgaagacggagacattatctgtttccaa
aaggctcctgttccagatggtgatgcacaagtgcgctatccagatgttccttcattcttg
gagtatgttcacaataggcaggttgtgcactttcggtgtctggacaaaccaaaggatgat
gatttttctttggaattgtcgaagcttcatacatatgatgatgttgttgagagagttgca
catcaacttgggttggatgatccatcaaagatacggcttacgtctcacaattgttattct
cagcaacctaaaccacagcctattagatataggggggtagcacatctactggatatgctt
gttcattataatcagacttctgatatcttgtattatgaggttctggacattccactgcca
gatttgcagcgtttgaaaacgcttaaagttgcattccaccatgcaacaaaagacgaggtt
gtcgttcatagcataagacttccaagaaatagcaccatcagtgatgtgattactgatttg
aaaaccaaggttgaactatctaatcctgacgctgagctccgcttgcttgaagtattttac
cacaagatttataagatctttccacctcatgagaagatagagaacataaatgatcagtac
tggacattacgagctgaggagatcccagaggaagagaagaatcttggcccacatgatcga
ttgattcatgtttaccatttcatgaaagaccctaaccagaatcaacaaattcaaaatttt
ggagatccttttttgatggttattcgggaaggtgagactgctgcagaggtaatggagcgc
atccagagaaaacttagagttcctgatgatgagttctccaagtggaagcttgcattcata
tccatgaaccggccagagtacctccaggacactgacgttgtatcagcacgttttcagcgg
agagatgtatatggtgcttgggaacaataccttggcttggagcacactgatacaacatcg
aaacggtcttacacatccaatcagaatcggcacacctatgagaagcccgtaaaaatttat
aattga

  All links  
No link information was found.   
DBGET integrated database retrieval system