KEGG   Zea mays (maize): 100383375Help
Entry
100383375         CDS       T01088                                 

Definition
palmitoyl-protein thioesterase 1 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
zma  Zea mays (maize)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100383375
  Lipid metabolism
   00062 Fatty acid elongation
    100383375
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100383375
Lipid biosynthesis proteins [BR:zma01004]
 Fatty acid synthase
  Component type
   100383375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MRRTATAALVLVPLLAAAVQTSALPFIVLHGIGDQCVNHGVAKFTKLLADWSGSDGYCLE
IGRGTWDSWVMPLQQQADIICNKVKEMKQLRGGYNIVGLSQGNLIGRAVVEYCDDGPPVK
NFISLGGPHAGTASVPLCGSGFFCIIVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYL
KSCRFLPKLNNEIPDKRNATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDP
VLPPQKTKLYEEDWIGLKTLDEAGRVKFVSVPGGHLGISKGDMKKYIVPYLTNKKASVTV
SDLLVAIWHAVLGLALAEGDDAVLI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcggagaacagctaccgccgccctcgtcctcgtccccctcctcgctgcggcggtacag
acctccgccctgcctttcatcgtcctgcacgggattggggaccagtgcgtcaaccatggc
gttgccaagttcactaaacttctcgccgattggtccggctccgacggctactgcctagag
attggcagaggaacatgggactcttgggtcatgcctcttcaacaacaggctgatataatc
tgcaacaaggtcaaggaaatgaaacaactgagaggtggctacaacatagttggtctgtct
caggggaacttgattggtcgagcagtggttgagtactgtgatgatggaccgccggtcaag
aatttcatctctctaggaggtcctcatgctggtaccgcttcagtgcctctttgtggttct
ggatttttttgcattattgttgatgctctgatcaaattggagatctactcagactatgtg
caggaacatcttgcacctagtggctacctcaaaatcccaactgatatggcagattatctg
aagagttgtaggtttcttccaaaacttaacaatgaaattccagataaaagaaatgccacc
tacaaggaaagattcagtagcttagagaatttggttctgattatgtttcaggatgatgca
gtcctgataccacgagaaacggcatggtttggttactaccctgatggagcctttgatcca
gttctaccacctcagaagacgaaactgtatgaggaagactggattggtttgaagacactg
gatgaagcagggcgggtgaagtttgtgtctgtgccgggaggtcatcttggtatctccaaa
ggtgacatgaagaagtacattgtgccttacctgacaaacaaaaaggcatcggtgacggtt
tctgatttgctagttgccatttggcacgctgtgcttgggctggcactggcagagggtgat
gacgctgttttgatttga

DBGET integrated database retrieval system