KEGG   Zea mays (maize): 100383472Help
Entry
100383472         CDS       T01088                                 

Gene name
IVR1
Definition
(RefSeq) beta-fructofuranosidase 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
zma  Zea mays (maize)
Pathway
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100383472 (IVR1)
   00500 Starch and sucrose metabolism
    100383472 (IVR1)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100383472 (IVR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 100383472
NCBI-ProteinID: NP_001169591
UniProt: C0PG85
Position
2
AA seq 485 aa AA seqDB search
MVPDHPYDANGVWSGSATRLPDGRIVMLYTGSTAESSAQVQNLAEPADASDPLLREWVKS
DANPVLVPPPGIGPTDFRDPTTAWRTPGNDTPAWRVAIGSKDRDHAGLALVYRTEDFVRY
DPAPALMHAVPGTGMWECVDFYPVAAGSGAAADSGDGLETSAAPGPGVKHVLKASLDDDK
HDYYAIGTYDPATDTWTPDSAEDDVGIGLRYDYGKYYASKTFYDPVLRRRVLWGWVGETD
SERADILKGWASVQSIPRTVLLDTKTGSNLLQWPVVEVENLRMSGKSFDGVALDRGSVVP
LDVGKATQLDIEAVFEVDASDAAAVTEADVTFNCSTSAGAAGRGLLGPFGLLVLADDDLS
EQTAVYFYLLKGTDGSLQTFFCQDELRASKANDLVKRVYGSLVPVLDGENLSVRILVDHS
IVESFAQGGRTCITSRVYPTRAIYDSARVFLFNNATHAHVKAKSVKIWQLNSAYIRPYPA
TTTSL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccgatcacccgtacgacgccaacggcgtctggtccgggtcggcgacgcgcctg
cccgacggccggatcgtcatgctctacacgggctccacggcggagtcgtcggcgcaggtg
cagaacctcgcggagccggccgacgcgtccgacccgctgctgcgggagtgggtcaagtcg
gacgccaacccggtgctggtgccgccgccgggcatcgggccgacggacttccgcgacccg
acgacggcgtggcggacgcccggcaacgacacgccggcgtggcgggtcgccatcgggtcc
aaggaccgggaccacgcgggcttggcgctggtgtaccggacggaggacttcgtgcggtac
gacccggcgccggcgctgatgcacgccgtgccgggcacgggcatgtgggagtgcgtggac
ttctacccggtggccgcgggatcaggcgccgcggcggacagcggggacgggctggagacg
tccgcggcgccggggcccggggtgaagcacgtgctcaaggccagcctcgacgacgacaag
cacgactactacgcgatcggcacctacgacccggcgacggacacctggacccccgacagc
gcggaggacgacgtcggcatcggcctccggtacgactacggaaagtactacgcgtccaag
accttctacgaccccgtccttcgccggcgggtgctctgggggtgggtcggcgagaccgac
agcgagcgcgcggacatcctcaagggctgggcatccgtgcagtcaatccccaggacggtc
ctcctggacacgaagacgggcagcaacctgctccagtggccggtggtggaggtggagaac
ctccggatgagcggcaagagcttcgacggcgtcgcgctggaccgcggatccgtcgtgccc
ctcgacgtcggcaaggcgacgcagttggacatcgaggctgtgttcgaggtggacgcgtcg
gacgcggcggccgtgacggaggccgacgtgacgttcaactgcagcaccagcgctggcgcg
gcgggccggggcctgctcggcccgttcggccttctcgtgctggcggacgacgacttgtcc
gagcagaccgccgtgtacttctacctgctcaagggcacggacggcagcctccaaactttc
ttctgccaagacgagctcagggcatccaaggcgaacgatctggttaagagagtatacggg
agcttggtccctgtgctagatggggagaatctctcggtcagaatactggttgaccactcc
atcgtggagagctttgctcaaggcgggaggacgtgcatcacgtcgcgagtgtaccccaca
cgagccatctacgactccgcccgcgtcttcctcttcaacaacgccacacatgctcacgtc
aaagcaaaatccgtcaagatctggcagctcaactccgcctacatccggccatatccggca
acgacgacttctctatga

DBGET integrated database retrieval system