KEGG   Zea mays (maize): 100383540Help
Entry
100383540         CDS       T01088                                 

Definition
uncharacterized LOC100383540
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 571 aa AA seqDB search
MATAAAAAVAAPEQPRRRKPAPGRGGVALPAGLSEEEARVRAIAEIVSAMGELSRRGEDV
DLNSLKSAACRRYGLARAPKLVEMIAAVPEADRATLLPRLRAKPVRTASGIAVVAVMSKP
HRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLK
RLGHSVDKVEFILMGGTFMSLPAEYRDYFIRNLHDALSGHTSANVEEAICYSEHSAVKCI
GMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKD
AGFKVVAHMMPDLPNVGVERDLESFREFFGSPAFRADGLKIYPTLVIRGTGLYELWKTGR
YRNYPPELLVDIVARILSLVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMEDLGL
KCRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTRQDILIGLLRLRKC
GRNVTCPELVGRCSIVRELHVYGTAVPVHGRDVDKLQHQGYGTLLMEEAERIARKEHRSK
KLAVISGVGTRHYYRKLGYELEGPYMVKCLA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgccgccgccgccgccgtggcggcacccgagcagccgcgtcgccggaagccg
gcgccggggcgtgggggcgtggccctccctgcgggactctcggaagaggaggccagggtg
cgggccatcgccgagatcgtctcggcgatgggggagctctcgcggcgcggggaggatgtg
gaccttaactcgctcaagtctgccgcgtgccggagatacggtctggcgcgggcgcccaag
ctagtggagatgatcgccgccgtgcccgaggccgaccgtgccacgctgcttccgcggttg
cgcgctaagcccgtgcgcacggcgtcgggtatcgccgtcgtcgccgtcatgtcgaagccg
caccgttgcccacacatcgccaccaccgggaacatctgtgtctactgccccggcggtccc
gattccgacttcgagtacagcacgcaatcctacacgggatacgagcccaccagcatgcgt
gccattcgggcaaggtataatccatatgtgcaagccaggagcaggatagatcagctcaag
aggctagggcatagcgtggataaggtcgaattcatcttgatgggtgggactttcatgtcc
ttaccagctgaatatcgtgattatttcatcagaaatcttcatgatgctttatcgggtcac
acttctgcaaatgttgaggaggctatttgttattcggaacatagtgctgtcaaatgtatt
ggtatgacgattgagacgagacctgattattgcttggggcctcatctgcgccagatgcta
tcttatggttgtacccgcttggaaattggtgtccagagtacatatgaggatgttgcccgt
gacacaaacagaggacacacagtggctgctgttgctgattgcttctgtttggcaaaagat
gctgggtttaaggtggttgcccacatgatgccagatttacctaatgttggagttgaaaga
gatttggaaagtttcagagaattttttggaagtccagcgttccgggctgatggtctgaag
atttatccaacacttgtgattcgtggaactggtctttatgagctctggaaaactggcaga
tatagaaattatccacctgagctgttggtggatattgtggcaagaattctgtctttggta
ccaccttggacacgagtgtatcgggtccagagagatattcctatgcctcttgttacttct
ggtgtcgagaaaggtaaccttcgcgagcttgctttggctcgaatggaagatctgggctta
aaatgccgggacgtcagaacccgtgaggcagggattcaggatatccatcacaagatccgg
ccagatgaagtagagcttgtcagacgtgactatgctgcaaatgagggttgggaaacattc
ctctcttatgaggatacacgacaggatatcctgatcgggctgttgcgcttgcgtaaatgt
ggccgtaatgttacatgccctgaacttgtagggaggtgttcaattgtgcgtgagcttcat
gtctatggaactgcagtccctgtgcatggccgtgatgtggacaaactgcagcaccaggga
tacggaactctattaatggaagaagcagaaaggattgctcgaaaggagcaccgatcgaag
aaattagctgtcatttcgggggttggtactcgccactactaccgcaagttgggttatgag
ctagaagggccttacatggttaaatgtttggcgtaa

DBGET integrated database retrieval system