KEGG   Zea mays (maize): 100383712Help
Entry
100383712         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100383712
   00052 Galactose metabolism
    100383712
Enzymes [BR:zma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100383712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 381 aa AA seqDB search
MARAAAPPPLHRLPGLALLCLAVAVCFSGGENAAAAAWTRKIVGVHELRVGDFSVKVTNW
GATLMSVILPDSKGNLGDVVLGYDTVAEYVNGTAYFGGLIGRVANRVAGARFTLDGKAYR
LYRNDGNNSLHGGHRGFSKVVWTVKEHVGGGDSPYITLYYHSFDGEQGFPGDLDVYVTYR
LSRPYVLSVRMNATARSRATPVNLAHHAYWNLGGHGSGPVLGETVQLFASRYTPVDAALV
PTGALAPVAGTPYDFRAPAPVGARLADLRPRRGTGGVAGYDTNYAVDGAASPSLRPVARV
WDGATGRAMELWADQPGVQFYTSNGLAGVRGKGGSVYRRYAALCLETQGFPDAVNHPSFP
SQIVRPGKVYSHDMLFKFSFA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagcggcggctcctccgcctctgcaccggctgcccggtctggccttgctgtgc
cttgccgtggcagtttgcttctccggcggcgaaaacgccgcggcggcggcctggacgagg
aagatagtcggcgttcacgagctcagggtgggggatttctccgtcaaggtcaccaactgg
ggggcgactctcatgtccgtcatcctccccgactccaaagggaacttgggcgacgttgtg
ctcggctacgacaccgtcgctgaatacgtcaacggcaccgcctacttcggcggtctgatc
ggccgcgtggccaacagggtcgccggcgcgcggttcacgctggacgggaaagcctaccgc
ctctaccgcaacgacggcaacaactcgctccacggtggccaccgggggttcagcaaggtc
gtatggacggtgaaggagcacgtcggcggcggtgactccccgtacatcacgctctactac
catagcttcgacggggagcaagggttccccggcgacctggacgtgtacgtgacgtaccgt
ctgtcgcgcccgtacgtgctgagcgtgcgcatgaacgccacggcgcggagcagggccacc
ccggtgaacctcgcgcaccacgcgtactggaacctcggcggccacggcagcgggcccgtc
ctcggcgaaacggtgcagctcttcgcgtcgcggtacacgccggtggacgccgcgctcgtg
ccgacgggcgcgctggcgcccgtggccggcacgccctacgacttccgcgcgccggcgccc
gtgggggcgcgcctggcggacctgcggccgcgccgtggcactggcggcgtcgcgggctac
gacaccaactacgccgtggacggcgccgcgtcgccgtcgctgcggccggtggcgcgcgtc
tgggacggcgccacggggcgggccatggagctgtgggcggaccagcccggggtgcagttc
tacaccagcaacgggctcgctggcgtcaggggcaagggcggtagcgtgtaccggcggtac
gccgcgctgtgcctcgagacgcaggggttccccgatgccgtcaaccacccgagcttcccg
tcgcagatcgtgaggccgggcaaggtgtatagccatgacatgctctttaagttctccttc
gcctag

DBGET integrated database retrieval system