KEGG   Zea mays (maize): 100383910Help
Entry
100383910         CDS       T01088                                 

Definition
uncharacterized LOC100383910
Orthology
K11155  
diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
zma  Zea mays (maize)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:zma00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 233 aa AA seqDB search
MMAPTLCYQPSYPRTPYVRKGWLVRQVILYLIFTGLQGFIIEQYINPIVVNSQHPLMGGL
LNAVETVLKLSLPNVYLWLCMFYCLFHLWLNILAEILRFGDREFYKDWWNAKTIDEYWRK
WNMPVHKWIVRHIYFPCMRNGISKEVAVFISFFVSAVLHELCVAVPCHILKFWAFLGIML
QIPLIILTSYLKNKFSDTMVGNMIFWFFFCIYGQPMCVLLYYHDVMNRTEKAK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatggctccgacactctgttatcagccaagttatcctcgaacaccttatgttagaaaa
ggttggctggtccgtcaagttattctatacttgatatttactggtctccaaggattcatt
attgagcaatacataaatcctattgttgtgaactctcaacatccattgatgggaggatta
ctgaatgctgtagagactgttttgaagctctcattaccaaatgtctacctgtggctttgc
atgttttattgccttttccatctgtggttaaacatacttgctgagattcttcgatttggt
gaccgagaattctacaaagactggtggaatgcaaagacaattgatgagtactggagaaaa
tggaacatgcctgtgcataaatggattgttcgtcatatatatttcccttgcatgcgaaat
ggtatatcaaaggaagttgctgtttttatatcgttctttgtttctgctgtacttcatgag
ttatgtgttgctgttccctgccacatactcaagttctgggctttcttaggaatcatgctt
cagattcccctcatcatattgacatcatacctcaaaaataaattcagtgacacaatggtt
ggcaatatgatcttttggttttttttctgcatatacgggcagccaatgtgtgttctattg
tattaccatgatgtgatgaaccggactgagaaggcaaaataa

DBGET integrated database retrieval system