KEGG   Zea mays (maize): 100383910Help
Entry
100383910         CDS       T01088                                 

Definition
uncharacterized LOC100383910
Orthology
K11155  
diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
zma  Zea mays (maize)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100383910
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     100383910
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     100383910
    2.3.1.76  retinol O-fatty-acyltransferase
     100383910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 233 aa AA seqDB search
MMAPTLCYQPSYPRTPYVRKGWLVRQVILYLIFTGLQGFIIEQYINPIVVNSQHPLMGGL
LNAVETVLKLSLPNVYLWLCMFYCLFHLWLNILAEILRFGDREFYKDWWNAKTIDEYWRK
WNMPVHKWIVRHIYFPCMRNGISKEVAVFISFFVSAVLHELCVAVPCHILKFWAFLGIML
QIPLIILTSYLKNKFSDTMVGNMIFWFFFCIYGQPMCVLLYYHDVMNRTEKAK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatggctccgacactctgttatcagccaagttatcctcgaacaccttatgttagaaaa
ggttggctggtccgtcaagttattctatacttgatatttactggtctccaaggattcatt
attgagcaatacataaatcctattgttgtgaactctcaacatccattgatgggaggatta
ctgaatgctgtagagactgttttgaagctctcattaccaaatgtctacctgtggctttgc
atgttttattgccttttccatctgtggttaaacatacttgctgagattcttcgatttggt
gaccgagaattctacaaagactggtggaatgcaaagacaattgatgagtactggagaaaa
tggaacatgcctgtgcataaatggattgttcgtcatatatatttcccttgcatgcgaaat
ggtatatcaaaggaagttgctgtttttatatcgttctttgtttctgctgtacttcatgag
ttatgtgttgctgttccctgccacatactcaagttctgggctttcttaggaatcatgctt
cagattcccctcatcatattgacatcatacctcaaaaataaattcagtgacacaatggtt
ggcaatatgatcttttggttttttttctgcatatacgggcagccaatgtgtgttctattg
tattaccatgatgtgatgaaccggactgagaaggcaaaataa

DBGET integrated database retrieval system