KEGG   Zea mays (maize): 100383928Help
Entry
100383928         CDS       T01088                                 

Definition
uncharacterized LOC100383928
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100383928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 439 aa AA seqDB search
MGSMEASTAPENGSAAGGGAGNGAGAASNGGGVERRLRSSAAPASWAAQLPLEVGTRVMC
RWRDQKLHPVKVIERRKGSASSSPADYEYYVHYTEFNRRLDEWVKLEQLDLATVETDVDE
KVEDKATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIAKIELGRYEIDT
WYFSPFPPEYNDCPKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMFEV
DGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEES
YNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLE
ILKKHKGNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLKAAGR
GGLDVDVSKLIWTPYKEQG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgggctctatggaagcgtcgaccgcgccggagaacggctccgccgccggtggcggagcc
ggcaacggggcgggcgccgcgtcgaacggaggaggtgttgagaggaggctgaggtcctcg
gctgcgcccgcgtcgtgggcagcccagcttcccctggaggtgggcacacgcgtgatgtgc
cggtggcgcgaccagaagctccaccctgtcaaggtcatcgagcgccgcaagggctccgct
tcctcttcccccgctgactacgagtactacgtccattacaccgagttcaatagaagactt
gacgagtgggttaagcttgagcagcttgatcttgctactgtcgagaccgatgttgatgag
aaagtcgaagataaggcaacaagcttaaagatgacacggcaccagaagcgtaaaattgat
gaaacacatgtggagcaaggacacgaggagcttgatgcagccagcttgcgggaacatgaa
gaattcacaaaagtgaaaaatattgcaaagattgaacttgggagatatgagatagataca
tggtatttctctccttttccaccagagtacaatgactgcccgaagctgtttttctgtgaa
ttttgcctcaacttcatgaagcgcaaagaacagcttcagaggcacatgaagaagtgcgat
cttaagcaccctccaggtgatgaaatctatagaagtggaactctttcgatgttcgaggtt
gatgggaagaagaacaaggtttatggacagaatctttgttatctggccaagctatttctt
gatcacaagacattgtactatgatgttgatttattcttgttttatgttctctgcgaatgt
gatgaccggggatgtcatatggtgggatatttctctaaggaaaaacactctgaagaatct
tataatttggcttgcattctcactcttcccccataccaaagaaaaggatatgggaagttc
ctgattgctttctcatatgaactttccaagaaggaaggtaaagttgggacaccggagcgc
cctctttctgatcttggcctgctcagctatagaggttattggactagagtgcttctggaa
attctaaagaaacataagggtaacatatctataaaggaactcagcgacatgacggcaata
aaagccgatgacatcttgagcacgctgcagagcctggacctaatccagtatcgcaaaggg
cagcacgtcatctgcgcggacccgaaggtcctcgaccgccacctgaaggcggcgggtcgg
ggaggcctggacgtggacgttagcaagctgatctggactccctacaaggagcaaggctaa

DBGET integrated database retrieval system