KEGG   Zea mays (maize): 100384136Help
Entry
100384136         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
zma  Zea mays (maize)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:zma00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:zma00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:zma00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:zma00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:zma00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 525 aa AA seqDB search
MAPAAALALSLLLAFLAIGPCAAADSIDLWPMPQSVSHGTQKLYVKKDITMSMVGSTYSD
EKSILKDAFQRMLDLITLNHVIDGIDPGSSVLTCVNVVVRTPEDELSFGADESYNLTVPT
TGDPLYAQIQAQTVFGALQALQTFGQLCYFDFTSRLIELNSAPWIITDRPRFPYRGLLID
TARHYLPVKTIKGVIDAMAYSKLNVLHWHIVDEQSFPIEIPSYPKLWNGSYSYSERYTMS
DAIDIVRYAEKRGVNVLAEIDVPGHARSWGIGYPALWPSESCREPLDVSKNFTFEVIDGI
LSDFSKIFKFKFVHLGGDEVNTSCWTRTPHIEGWLNNNHMNVSDAYRDFVLRSQKIAISH
GYDVINWEETFNSFGDKLDPKTVVHNWLGEDVAPKVVAAGHRCIVSNQDKWYLDHLDASW
EGFYMNEPLKGINDTKQQQLVIGGEVCMWGEEIDASDIQQTIWPRAAAAAERLWTPIEKL
ANDTRFVTSRLARFRCLLNQRGVAAAPLAGYGRASPSEPGPCVRQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggcggcggctctggctctgagtctgctcctcgcgttcctggcgatcgggccc
tgcgccgccgccgacagcatcgacctgtggccgatgccgcagtcggtgtcgcacgggacg
cagaagctctacgtcaagaaggacatcaccatgtcgatggtggggagcacgtactccgac
gagaaatcgatcctcaaggacgcgttccagcggatgcttgacctgatcacgctgaaccac
gtcatcgacggaatcgacccaggctcctcggttctcacctgcgttaatgtggttgtgcgt
acacctgaagacgagcttagctttggggcagatgagtcgtataacctgactgttccaacg
acaggagacccactgtatgcacagatccaggctcaaacagtgtttggagcgcttcaagcc
ttgcagacgtttggtcagttatgttacttcgatttcacatcgcggctcattgagctcaac
tcggctccttggataataaccgacagacccaggtttccctaccggggactgcttattgat
accgcgagacactacctccctgttaagacaatcaaaggagtgattgatgcaatggcttac
agcaaattgaatgttctccattggcatatcgtggacgagcagtcgtttcccattgagata
ccctcataccccaaactgtggaacggttcatactcttattcagagagatatacgatgtct
gatgctattgacattgtacggtatgccgagaagcgaggtgtaaatgtgttggctgagatt
gatgttcctggccatgcccgctcatggggtatcggctacccagcattatggccatcagaa
agctgcagagaaccacttgatgtcagtaaaaacttcacgtttgaagtcatcgatggcatt
ctttcagattttagcaagatttttaagttcaaatttgtccacttaggaggtgatgaagtc
aacacaagctgctggaccagaacaccccatattgaaggatggttgaataataaccatatg
aacgtatcagacgcatacagagattttgtattgagatctcaaaagatcgcgatatcacat
ggctacgatgtcataaactgggaagagacatttaacagttttggagacaaattggaccct
aaaaccgtggtgcataactggcttggagaagatgtagcgcccaaagtggttgctgcaggg
cataggtgtatagtaagcaaccaggataagtggtacctggatcacttggatgcctcatgg
gaaggattttacatgaacgagcccctaaaaggtatcaatgatacaaagcagcagcaattg
gtcattggtggtgaggtttgcatgtggggtgaggaaattgatgcctcagatattcagcaa
acgatttggccacgtgccgcagcagctgcagagaggctgtggactccgattgagaagctc
gcaaatgacacaagatttgtcacgtcaagattggcgcgcttcaggtgtttgctgaaccaa
agaggagtagctgctgcgccattagcaggctatggtcgtgcatcaccatcagaacctggc
ccctgtgtaaggcaataa

DBGET integrated database retrieval system