KEGG   Zea mays (maize): 100384288Help
Entry
100384288         CDS       T01088                                 

Gene name
LIP1P-2
Definition
(RefSeq) lipoyl synthase 2, chloroplastic
  KO
K03644  
lipoyl synthase [EC:2.8.1.8]
Organism
zma  Zea mays (maize)
Pathway
Lipoic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    100384288 (LIP1P-2)
Enzymes [BR:zma01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     100384288 (LIP1P-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3
AA seq 367 aa AA seqDB search
MQSSLARPPVLAGCGERRGLAAVARCRAEAAAPVWTASRASAGPYTGRDPEVKKPAWLRQ
RAAQGEKYARLRESIGELKLNTVCVEAQCPNIGECWNGGGGAGGEGDGIATATIMVLGDT
CTRGCRFCAVKTSNKPPPPDPLEPLNTALAVASWGVDYVVLTSVDRDDLPDGGSSHFAQT
VKALKELKPGILVECLTSDFRGDLEAISSLANSGLDVYAHNIETVRSLQRVVRDPRAGYD
QSLAVLKHAKGSREDMITKSSIMLGLGETDEEVKQAMMDLRAIGVDILTLGQYLQPSERH
LTVREYVTPQKFQFWKEYGESVGFRYVASGPLVRSSYRAGELFIQNLVRNNKTESSMDPY
AEITKSN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcagagctccctcgcccggccgccggtactggccggatgcggcgagagacggggcctg
gcagccgtggcacggtgccgcgctgaggcggcggcgcccgtgtggacggcgtccagggcg
tctgcggggccgtacaccgggagggacccggaggtgaagaagcccgcgtggctgcggcag
cgcgctgcgcagggggagaagtacgctcgcctgcgggagtccatcggcgagctcaagctc
aacaccgtctgcgtcgaggcacagtgccccaacatcggcgagtgttggaacggaggtgga
ggggccggcggcgaaggggacggcatcgcgacggccaccatcatggtgcttggtgacacc
tgcacgcgcgggtgtcgattctgcgctgtgaagaccagcaacaaaccgccgccgcctgat
cccctggagcctctgaacacggctttggctgttgcaagctggggtgtagattatgttgtg
ctaaccagtgtcgatagagatgacttacctgatggtggaagtagccattttgctcagaca
gtgaaagctttaaaggagctcaaacctggaatactggtagagtgcttaacctcggatttt
cgaggtgacctggaggctatctcatctttggcaaactctggcctagatgtttatgcacac
aacattgaaactgtgaggagtctacagagggttgtgagggatccccgggcagggtatgat
cagagcttagcagttctcaagcatgcaaaaggttccagggaggacatgattacaaagtct
tctatcatgcttggtcttggagagactgatgaagaggtgaaacaagccatgatggatcta
cgggcaattggtgttgacatccttactttgggacagtacttgcagccatcagaaagacat
ctaacagtaagagagtatgtgactccccaaaagttccaattttggaaggagtatggagaa
tcggtgggtttccgatatgttgctagcggacccttggttcggtcttcctaccgtgcagga
gagctatttatccaaaatttagtcagaaataacaaaactgagtcgtccatggatccgtac
gcagaaataacaaaatctaactaa

DBGET integrated database retrieval system