KEGG   Zea mays (maize): 100384307Help
Entry
100384307         CDS       T01088                                 

Definition
uncharacterized LOC100384307
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100384307
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100384307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MTVTVFSTDGSREPCSYDVSVPKFGTLSDLVQALSIVCLLGDDEILLVTEVYNNCIIRYL
EEPSDSVSLLRDGDKLAAYRLPKRHEKSPLVVFTHQHFVQHSSDGNLTPQMREFEAPLLA
ALPEEISGLSLQDIYLKLLSPFQLSNGASSLNDCMESNSDSVDTPSDSGSINFQNSQLED
GPESNHCSASECEVTKGPDDLYDGVSGSNKEAHMDFEFYLKSERGEGQQQKIEINELHLL
LETAPSRLHVNVHWLQNASRKYATSMLNNLPEIHKLELIPKGTEDSVALHGCLEAFLKEE
PLGPEDMWYCPRCKKHQQAMKKLDLWRLPEVLVIHLKRFSYTQFTRNKLETFVDFPYERG
QHKDPGCLCSVLQTRVTDWGLKRIFLQVGFGRQSRADCLPTQFAASGVSEFSNVSAFESL
KPY
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaacagttttcagcactgatggtagcagagaaccatgctcgtatgacgtcagt
gtgccaaaatttgggactctgagtgatcttgttcaggctttaagcattgtttgcctactt
ggagatgatgagatcctgctggttacagaggtctataataactgcatcatccgatacttg
gaggagccttcagattcagtttcattgctgagggatggagataaactagcagcataccgt
ctacccaaaagacatgagaaatccccccttgtggtttttacacaccaacattttgtccag
cattctagtgatggtaatttaactccacaaatgagggagtttgaggccccacttttggca
gcacttccagaggaaattagtggattatctcttcaggatatctacctaaagttgttgagt
ccatttcaactttccaacggggctagttcgcttaatgattgtatggagtctaatagtgac
tccgtcgatacgccttctgattcaggcagtatcaattttcagaacagccaattggaagat
ggccctgaaagcaaccactgtagtgctagtgaatgtgaagtaacaaaaggacctgatgat
ttatacgatggggtttctggttctaacaaggaagcacatatggacttcgaattttattta
aaaagtgaaaggggcgagggccagcaacagaagatagaaattaatgagctccatttatta
ttggagacagcaccaagccggttgcatgtgaatgtccactggctacagaatgcttcaaga
aaatatgccacctcaatgctgaacaatctacctgagatccacaagctcgagcttatcccg
aaaggaactgaagattctgttgcactacatggttgtctggaagcctttctaaaagaggaa
ccgttggggccggaggacatgtggtattgcccgcgctgcaagaagcatcagcaagcgatg
aagaaactggatctgtggaggctgcccgaggttctggtgatccacctcaaacggttctcc
tacacccagttcacaaggaacaagctggagacgttcgtcgacttcccctatgagcgagga
cagcataaagaccccggctgcctatgttctgttctacagacgagagtgactgactgggga
ttgaagcgcatttttctgcaggtgggttttggtcggcaatccagagcagactgcctccct
acacagtttgctgcttcaggcgtgtctgagttttctaacgtttcggcatttgaatctctc
aagccatactga

DBGET integrated database retrieval system