KEGG   Zea mays (maize): 100384307Help
Entry
100384307         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100384307
Organism
zma  Zea mays (maize)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
7
AA seq 423 aa AA seqDB search
MTVTVFSTDGSREPCSYDVSVPKFGTLSDLVQALSIVCLLGDDEILLVTEVYNNCIIRYL
EEPSDSVSLLRDGDKLAAYRLPKRHEKSPLVVFTHQHFVQHSSDGNLTPQMREFEAPLLA
ALPEEISGLSLQDIYLKLLSPFQLSNGASSLNDCMESNSDSVDTPSDSGSINFQNSQLED
GPESNHCSASECEVTKGPDDLYDGVSGSNKEAHMDFEFYLKSERGEGQQQKIEINELHLL
LETAPSRLHVNVHWLQNASRKYATSMLNNLPEIHKLELIPKGTEDSVALHGCLEAFLKEE
PLGPEDMWYCPRCKKHQQAMKKLDLWRLPEVLVIHLKRFSYTQFTRNKLETFVDFPYERG
QHKDPGCLCSVLQTRVTDWGLKRIFLQVGFGRQSRADCLPTQFAASGVSEFSNVSAFESL
KPY
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaacagttttcagcactgatggtagcagagaaccatgctcgtatgacgtcagt
gtgccaaaatttgggactctgagtgatcttgttcaggctttaagcattgtttgcctactt
ggagatgatgagatcctgctggttacagaggtctataataactgcatcatccgatacttg
gaggagccttcagattcagtttcattgctgagggatggagataaactagcagcataccgt
ctacccaaaagacatgagaaatccccccttgtggtttttacacaccaacattttgtccag
cattctagtgatggtaatttaactccacaaatgagggagtttgaggccccacttttggca
gcacttccagaggaaattagtggattatctcttcaggatatctacctaaagttgttgagt
ccatttcaactttccaacggggctagttcgcttaatgattgtatggagtctaatagtgac
tccgtcgatacgccttctgattcaggcagtatcaattttcagaacagccaattggaagat
ggccctgaaagcaaccactgtagtgctagtgaatgtgaagtaacaaaaggacctgatgat
ttatacgatggggtttctggttctaacaaggaagcacatatggacttcgaattttattta
aaaagtgaaaggggcgagggccagcaacagaagatagaaattaatgagctccatttatta
ttggagacagcaccaagccggttgcatgtgaatgtccactggctacagaatgcttcaaga
aaatatgccacctcaatgctgaacaatctacctgagatccacaagctcgagcttatcccg
aaaggaactgaagattctgttgcactacatggttgtctggaagcctttctaaaagaggaa
ccgttggggccggaggacatgtggtattgcccgcgctgcaagaagcatcagcaagcgatg
aagaaactggatctgtggaggctgcccgaggttctggtgatccacctcaaacggttctcc
tacacccagttcacaaggaacaagctggagacgttcgtcgacttcccctatgagcgagga
cagcataaagaccccggctgcctatgttctgttctacagacgagagtgactgactgggga
ttgaagcgcatttttctgcaggtgggttttggtcggcaatccagagcagactgcctccct
acacagtttgctgcttcaggcgtgtctgagttttctaacgtttcggcatttgaatctctc
aagccatactga

DBGET integrated database retrieval system