KEGG   Zea mays (maize): 100384703Help
Entry
100384703         CDS       T01088                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.4.19.12)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100384703
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100384703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 552 aa AA seqDB search
MSGGEKMLLFGSFTEDETKLFQGQPLKSPNKSVSKECERTEIQFGTLNFSVLSLEKVSTS
SVVLPAKSANSETSAITKENTCSNEKKAAGSSLPNGRAILANGCPPVNVPANNDLFENVK
KTEAVVPPVVPVKSISNPTPQMTLEVHNDGTEPTQSRKLDKEREITENGSPIVDTPIAAA
PAEEAVTNLNKKTSQNMPLIPQGLRNTGNICFLNATLQALLSCSPFVHLLQDLRNRSIPK
FGYPTLRAFVELISQFDVLDESVNKKKEKATTVAAKPLNPAMFDDVLRNFTPDVPAGITA
RPRQEDAQEFLSFAMDRVHDELLKLNGNGLDSKEGMVVSSSADDAWETVGRKNKSAIVRT
HSFVPSELSAIFGGQLQSVVKAAGNKASATVQPFLLLHLDIFPDAVQTLNDALRLFSTPE
SLEGYRTTAGKAGLVTARKSFKIHALPKIMILHLKRFSYGNNGSTKIYKPLGFTSELVLS
RDLLSSPSQEGRKYELVATITHHGRDPYRGHYTAHAKHADGQWLRFDDDAVVPVGENDVL
HDQAYVLFYKQV
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggcgagaagatgttgctgtttgggtcctttacagaggacgagactaagttg
ttccagggtcagcctctcaaaagtccaaataaaagcgtcagcaaagaatgtgaacggacg
gagatccagtttggcaccctgaacttttcagtgctgagtttagagaaggtatctacttcc
agtgttgttcttcctgcaaaatcagcaaacagcgagaccagtgccatcacaaaggagaat
acatgcagtaatgaaaagaaagctgcaggatcaagccttccaaatggcagagccattctg
gctaatggatgcccccctgttaatgttcctgccaacaatgatttatttgagaatgtgaag
aagacagaagctgttgtcccaccagttgtgcctgtaaaaagcatcagcaatccaacacca
caaatgacattggaggtgcataacgatggcaccgaacccactcaaagcagaaagttagac
aaggaaagggaaattactgaaaatggtagcccaattgtcgatacacccattgctgcagct
ccagcagaagaggcagtcacaaacctaaataagaaaacctcacagaacatgcccttgatt
ccacaaggcttgaggaacacaggaaatatctgctttctgaatgcaactttgcaggcattg
ctttcatgctcgccttttgtccaccttttacaggatctgaggaaccgtagtatacctaag
tttggctacccaactctgcgtgcatttgttgagttgatctctcaattcgatgtgcttgac
gagtcagttaacaagaaaaaagagaaggctactactgttgctgcaaagccacttaatcct
gccatgtttgatgatgttctcagaaactttacaccagatgtgccggctggaataactgct
cggccaaggcaggaagatgctcaagagtttttaagttttgccatggatagagtgcatgat
gaactgctgaagcttaatggtaatggtttggattcaaaggagggtatggttgtttcttct
tctgctgatgatgcttgggagacagttggaagaaagaacaaatctgcaatagttagaaca
catagttttgttccctctgagctaagtgctatttttggagggcagctacagagcgttgtg
aaagctgcaggtaacaaagcatcagctactgttcaaccctttctactgcttcatcttgat
atattcccagatgctgttcagacacttaatgatgcacttcgtctgttctctacccctgaa
tctttggaaggatacagaaccactgctggaaaggctggtttggtgacagctagaaagtca
ttcaagatacacgcccttccaaagataatgatcctgcacttaaagaggttcagttatgga
aataatgggagcactaaaatctacaagccactcggcttcacatctgaactggttcttagt
cgtgatctgctgagctcaccatcacaagagggtagaaaatatgagcttgttgcaaccatc
actcatcatgggagggacccttacagaggtcactacactgctcatgcaaagcatgccgac
gggcaatggcttcgctttgacgatgacgctgttgtgcccgttggcgagaacgatgtcttg
catgaccaagcatatgttctcttctacaaacaagtctga

DBGET integrated database retrieval system