KEGG   Zea mays (maize): 100501306Help
Entry
100501306         CDS       T01088                                 

Definition
uncharacterized LOC100501306
Orthology
K11252  
histone H2B
Organism
zma  Zea mays (maize)
Brite
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100501306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 149 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAAKAPAGKKPKAEKRLPAAKSSGKEGGDKKGKKKAKKSVE
TYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITSREIQ
TSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctaaggcggagaagaagccggctgcgaagaagccagcggaggaggagcccgct
gccgcgaaggccccggcggggaagaagcccaaggccgagaagcgcctcccggcggccaag
tcgtccggcaaagaaggcggcgacaagaagggtaagaagaaggcgaagaagtcggtggag
acctacaagatctacatcttcaaggtgctgaagcaggtccacccggacatcggcatctct
tccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaagctcgccggc
gaggctgccaagcttgcgcgctacaacaagaagcccaccatcacctctcgggagattcaa
acctctgtccgccttgtccttcccggcgagctcgccaagcacgcggtctccgagggcacc
aaggccgtcactaagttcacatcatcttag

DBGET integrated database retrieval system