KEGG   Zea mays (maize): 100502158Help
Entry
100502158         CDS       T01088                                 

Definition
uncharacterized LOC100502158
Orthology
K11252  
histone H2B
Organism
zma  Zea mays (maize)
Brite
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100502158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 150 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKTTAGKKPKAEKRVPAGKSAGKEGGEGKRGKKKGKKSV
ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITSREI
QTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggccgagaagaagcccgcggcgaagaagccggcggaggaggagcccgcg
gcggagaagacgaccgccgggaagaagcccaaggcggagaagcgggtccccgcgggcaag
tccgccggcaaggagggcggcgagggcaagcgtggcaagaagaagggcaagaagagcgtg
gagacgtacaagatctacatcttcaaggtgctgaagcaggtgcacccggacatcggcatc
tcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaagctggcc
ggcgaggccgccaagctcgcgcgctacaacaagaagcccaccatcacgtcccgcgagatc
cagacctccgtgcgcctcgtgctccccggcgagctcgccaagcacgccgtctctgagggc
accaaggccgtcaccaagttcacctcctcctag

DBGET integrated database retrieval system