KEGG   Zea mays (maize): 100502243Help
Entry
100502243         CDS       T01088                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
zma  Zea mays (maize)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100502243
  Lipid metabolism
   00600 Sphingolipid metabolism
    100502243
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100502243
   00604 Glycosphingolipid biosynthesis - ganglio series
    100502243
   00511 Other glycan degradation
    100502243
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100502243
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100502243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 672 aa AA seqDB search
MASGGTFRNLLLVLPLYLALASLVGGEASRRFWIENDTFRKDGVPFQIVGGDVHYFRIVP
EYWKDRLLRAKALGLNTIQTYVPWNLHEPEPQSWKFKGFTDIESYLRLAQELEMLVMLRV
GPYICGEWDLGGFPPWLLTIEPALKLRSSDSSYLSLVERWWGVLLLKVAPLLYNNGGPVI
MVQIENEFGSFGDDKNYLHHLVQLARRYLGNDIILYTTDGGALGNLKNGSIPQDDVFAAV
DFETGSNPWPIFKLQKKYNLPGKSVPLSSEFYTGWLTHWGERIATTDATSTAKALKTILC
HNGSAVLYMAHGGTNFGFYNGANTGQDESDYKADLTSYDYDAPIKEHGDVHNAKYKALRR
VIHECTGTPLHPLPANIKKASYGIMKLQKVVSLFDIIDNINDPLKVSVSEHPLYMEQIGQ
MFGFLLYMSEYQGKLPSSILSIPKVHDRAQVFVSCSAGVRTLRYCGVIERWSNKTLEIPN
LRCSSKTSLYILVENMGRVNYGPYIFDRKGILSPIQIDGITLRHWKMYPLALNSLDILPK
LQLITQIPYAGASKMSIHGDSEKILQDSSCCSNESTSAEPAFYEGHFRIDNETEIKDTFI
SFRGWNKGVAFVNNFNIGRFWPACGPQCTLYVPAPILRPGDNIVVIFELHAPNHELTIDF
TTDPDFTCGPEQ
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggtggaaccttccggaaccttctcctggtgctccccctctacctcgcgctc
gcctcgttggtcggtggcgaggcctcgaggaggttctggatcgagaacgatacctttagg
aaggatggagtaccgttccaaatcgtcggtggcgatgttcactatttccgcattgttcct
gagtactggaaggatcgccttttaagagcaaaagcattaggcttgaacacaattcaaaca
tatgtaccttggaatttgcatgagccagaaccacagagctggaaattcaagggcttcaca
gacattgaatcatatctgagacttgctcaagaactagaaatgctggtcatgcttcgtgta
gggccatacatttgtggagaatgggacttaggaggttttccaccttggttgctcaccata
gaaccagcccttaaactgcgttcatcagattcgtcctatctttccttggtggagagatgg
tggggagtactacttctgaaagtggcaccattattatacaataatggaggtccagttatt
atggttcagattgaaaatgaatttggttcttttggagatgataagaattaccttcatcac
cttgttcaactggccaggagatatcttggaaacgacattattctttatacaactgatggg
ggcgccttgggtaatttaaagaatggatcaattcctcaagatgacgtttttgctgctgtt
gattttgaaactggatccaatccatggcccatattcaaattacagaagaaatacaacttg
ccaggaaaatcagtccctttaagttcggaattttatactggatggctaacacactggggt
gaaagaatcgcaacaacagatgctactagtacagctaaagcccttaaaaccattttgtgc
cacaatggttctgctgtactttatatggctcatggcgggaccaattttggattttataat
ggtgcaaacactggtcaagatgaatctgattacaaggcagacctcacttcttatgactat
gatgcaccgattaaggagcatggagatgtgcataatgcaaaatacaaagcgctaagaaga
gtaatacatgagtgtactgggactcctctccatccacttcctgctaacattaaaaaagca
agttacgggattatgaaattacaaaaggttgtttctctgtttgacatcattgataatatc
aatgatcctctgaaagtttctgtttcggagcatccactttatatggaacagataggccag
atgtttggatttctcctgtacatgtcagaataccaagggaaactcccatcaagcatcctg
tcaattccaaaggtacatgacagagctcaggtgtttgtgtcttgctcagctggtgttaga
accctaagatattgtggtgtaattgaaagatggtctaataaaacactagagataccgaac
ttaagatgttcatctaagaccagcctatatatcctggtagaaaatatgggtcgtgtaaat
tatgggccatatatttttgaccggaagggaatactatctcctattcaaatagatggcatt
actctccgtcactggaaaatgtatccactggcactcaattcactggacatccttccaaaa
cttcaactaatcactcaaataccttatgctggagccagtaaaatgtccattcatggagac
tcagaaaagattttacaggactcgtcatgctgttcaaatgaaagcacttctgcggagcct
gcgttttatgaaggccatttccgtattgacaacgagactgagataaaggatacattcata
tcgtttcgtggttggaacaaaggtgttgcttttgtgaacaacttcaacattggaagattt
tggccggcatgcggaccacagtgtaccctttatgttccagcgcctatcctcagacctggg
gataacattgttgtaatctttgaactgcatgctccaaatcatgagctcactatcgatttt
accacggatccggatttcacgtgcggtccagaacagtga

DBGET integrated database retrieval system