KEGG   Zea mays (maize): 100856906Help
Entry
100856906         CDS       T01088                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
zma  Zea mays (maize)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100856906
Enzymes [BR:zma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100856906
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C44
   100856906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 604 aa AA seqDB search
MCGILAVLGCADEAKGSSKRSRVLELSRRLKHRGPDWSGLRQVGDCYLSHQRLAIIDPAS
GDQPLYNEDQSVVVAVNGEIYNHLDLRSRLAGAGHSFRTGSDCEVIAHLYEERGEEFVDM
LDGVFSFVLLDTRHGDRAGSSFFMAARDAIGVTPLYIGWGVDGSVWISSEMKALHDECEH
FEIFPPGHLYSSNTGGFSRWYNPPWYDDDDEAVVTPSVPYDPLALRKAFEKAVVKRLMTD
VPFGVLLSGGLDSSLVAAVAVRHLAGTEAARRWGTKLHSFCVGLEGSPDLKAAREVAEYL
GTLHHEFHFTVQDGIDAIEDVIYHTETYDVTTIRASTPMFLMSRKIKSLGVKMVISGEGS
DELFGGYLYFHKAPNKEGLHRETCRKVKALHQYDCLRANKATSAWGLEARVPFLDKEFIN
AAMSIDPQWKMVRPDLRRIEKWVLRKAFDDEEQPFLPKYILYRQKEQFSDGVGYSWIDGL
KTHAASNVTDKMLSNAKFIFPHNTPTTKEAYYYRMVFERFFPQKSAILTVPGGPSVACST
AKAIEWDTQWSGNLDPSGRAALGVHLAAYEHQHDPEHVPAAIATGSGKKPRTIRVAPPGV
AIEG
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatacttgctgtgctcgggtgcgccgacgaggccaagggcagcagcaagagg
tcccgggtgctggagctgtcgcggcggctgaagcaccggggccccgactggagcggcctc
cggcaggtgggcgactgctacctctcccaccagcgcctcgccatcatcgacccggcctct
ggcgaccagcccctctacaacgaggaccagtctgtggtcgtcgccgtcaacggcgagatc
tacaaccacctggacctcaggagccgcctcgccggcgcaggccacagcttcaggaccggc
agcgactgcgaggtcatcgcgcacctgtacgaggagcgtggagaagagttcgtggacatg
ctggacggcgtcttctccttcgtgctgctggacactcgccatggcgaccgcgcgggcagc
agcttcttcatggctgctcgcgacgccatcggtgtgacgcccctctacatcggatgggga
gtcgatgggtcggtgtggatttcgtcggagatgaaggccctgcacgacgagtgtgagcac
ttcgagatcttccctccggggcatctctactccagcaacaccggcggattcagcaggtgg
tacaaccctccttggtacgacgacgacgacgaggccgtcgtcaccccgtccgtcccctac
gacccgctggcgctaaggaaggcgttcgagaaggccgtggtgaagcggctgatgacagac
gtcccgttcggcgtcctgctctccggcgggctggactcgtcgctggtggcggccgtcgcc
gtgcgccacctcgccgggacagaggccgccaggcgctggggcaccaagctccactccttc
tgcgtgggcctggaggggtcccctgacctcaaggcggccagggaggtggcggagtacctg
ggcaccctgcaccatgagttccacttcactgttcaggacggcatcgacgccatcgaggac
gtgatctaccacacggagacgtacgacgtcaccacgatcagggcgagcacgcccatgttc
ctcatgtcgcgcaagatcaagtcgctcggggtcaagatggtcatctccggcgagggctcc
gacgagctcttcggaggctacctctacttccacaaggcgcccaacaaggaggggttgcac
cgagagacgtgtaggaaggttaaggctctgcatcagtatgactgcctgagagccaacaag
gcgacatcagcttggggcctggaggctcgcgtcccgttcctggacaaggagttcatcaat
gcggccatgagcatcgatcctcagtggaagatggtccggcctgatcttagaaggattgag
aagtgggtgctgaggaaggcattcgacgacgaggagcagccattcctgcccaagtatatc
ctctatagacagaaggagcagttcagtgacggcgtcgggtacagctggatcgatggcctg
aagactcatgcagcatcaaatgtgactgacaagatgctgtcgaatgcaaagttcatcttc
ccacacaacactccaaccaccaaggaagcctactactacaggatggtcttcgagaggttc
ttcccacagaaatctgctatcctgacggtacctggcgggccaagtgtggcgtgcagcaca
gccaaggccatcgagtgggacacacagtggtcagggaacctggacccctcggggagggcg
gcgctgggcgtccatctcgccgcctatgaacaccaacatgatcccgagcatgtcccggcg
gccattgcaacaggaagcggcaagaagccaaggacgatcagggtggcaccgcctggcgtt
gccatcgagggatag

DBGET integrated database retrieval system