KEGG   Zea mays (maize): 100857094Help
Entry
100857094         CDS       T01088                                 

Definition
uncharacterized LOC100857094
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
zma  Zea mays (maize)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100857094
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100857094
Transfer RNA biogenesis [BR:zma03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100857094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 411 aa AA seqDB search
MPLLHLSLPSHRLLVGGRGRLFFPSSPRRICLSVRAAGDAAVSVAEGAYGLPFRPEGAAH
HRELSAAVAVVERACRLCVDVKRSLFSRRSSILEKNDQSPVTVADFGVQALISLELQRLF
PSIPLVAEEDSASLRSSKADDNSSDILVESIFSAVVDKVSNNGSHLTQDDVLRAIDRGGK
DAVSFDSNPATYWVGLALVVNGKVTVGVMGCPNWTNDDIVNKKDDSVAACNGRGILMVSH
IGCGTWSRRLSADIGQFNTAQDIWKRCFVDTCSIAHMAHYCIPDSQTWDMIPLSATYDST
TDATDPRNENEILLLSVFCGSLCKYLTIASGRASVFVLQALPTTQIKSWDHAVGVICVQE
AGGQTSDWSGEPLDLAADLTSRRIIYPRGGVLVTNGALHDKLVEMISASYK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttctccacctctcgctcccgtcgcaccgcctcctcgtcggcggccgaggtcgg
ctgttcttcccgtcgtctccccgtcgtatctgcctatctgtcagggcggctggggatgcg
gcggtttcagttgcagagggggcttacggactccccttccggccggagggcgccgctcac
caccgcgagctctccgcggcagtggccgtcgtcgagcgcgcctgccgcctctgcgttgac
gtgaagagatcactgttttcacgtcgcagcagtattcttgagaagaatgaccaaagtcct
gttacagttgcagatttcggagtgcaggcccttattagtttggagctccagagattgttc
ccatcgatacctctggtggccgaagaggattcagcttctctaagatcatccaaagctgat
gataatagcagtgatatacttgttgagtcgatttttagcgcagttgtagacaaagtgagt
aataacggttcacatttaactcaagatgatgtcttgagagcaattgatagaggaggcaag
gacgctgtctcatttgattcaaaccctgctacttattgggtgggtctggcacttgtggtg
aatggaaaggtaacagttggagtgatgggatgtccaaattggaccaacgatgacatagtc
aacaagaaagatgatagcgttgctgcatgtaatggtcgtggtattcttatggtctcccat
attggctgtggcacatggtctaggcgtctgtctgctgatattggtcagttcaatacagct
caggatatttggaaaagatgttttgtggacacttgttcgatcgcacacatggcacactat
tgcattccagatagccaaacatgggatatgataccgttatctgctacctacgattcaaca
acggatgcaactgatcctagaaatgagaatgaaatccttctcctgtccgttttttgtggc
agcttgtgcaagtatctcacaattgcttccgggagagcctcggtttttgtccttcaagca
ctgccgacaactcagatcaagtcttgggatcacgctgttggggtaatctgcgtgcaggag
gccggtggtcagaccagtgactggagtggagaaccgttggatcttgcagctgacctaaca
tcgcgcagaatcatctaccctcggggcggtgttctggtgacaaatggtgcgctgcatgac
aagcttgtcgaaatgatctcagcaagttacaagtag

DBGET integrated database retrieval system