KEGG   Zea mays (maize): 541662Help
Entry
541662            CDS       T01088                                 

Gene name
PRO4
Definition
(RefSeq) profilin-4
  KO
K05759  profilin
Organism
zma  Zea mays (maize)
Brite
Membrane trafficking [BR:zma04131]
 Others
  Actin-binding proteins
   Others
    541662 (PRO4)
Cytoskeleton proteins [BR:zma04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     541662 (PRO4)
Exosome [BR:zma04147]
 Exosomal proteins
  Proteins found in most exosomes
   541662 (PRO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 541662
NCBI-ProteinID: NP_001104885
UniProt: O22655 B4FTX3
Position
6
AA seq 131 aa AA seqDB search
MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL
APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE
RLGDYLIEQGF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcgtacgtcgacgagcacctgatgtgcgagatcgaaggacagcatctc
agcgccgccgccatcgtcggtcacgacggcagcgtttgggcgcagtccgagagcttcccc
gagttaaagcctgaggaggttgctggtatcataaaggactttgatgaacctggtactctt
gcaccaactggtcttttcgttggaggtacaaagtacatggtgatccaaggtgaacctgga
gttgtcatccgaggaaagaagggcactgggggcattactatcaagaaaaccggcatgtcc
ttgattattggtgtctacgacgagccaatgactccagggcaatgcaacatggtggtggag
aggctcggcgattacctgatcgagcagggcttctaa

DBGET integrated database retrieval system