KEGG   Zea mays (maize): 541677Help
Entry
541677            CDS       T01088                                 

Gene name
pdlk1, PDK1
Definition
pyruvate dehydrogenase (lipoamide) kinase1
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 363 aa AA seqDB search
MASEPVARAVAEEVARWGAMRQTGVSLRYMMEFGARPTERTLLLAAQFLHKELPIRIARR
ALDLDSLPFGLSTKPAILKVKDWYVESFREIRSFPEVRNQKDELAFTQMIKMIRVRHTNV
VPAIALGVQQLKKDLGGPKAFPPGIHEIHQFLDRFYMSRIGIRMLIGQHVALHDPDPEPG
VIGLINTKMSPMTVARIASEDARAICMREYGSSPDVDIYGDPGFTFPYVTPHLHLMIFEL
VKNSLRAVQERYMDSDKLAPPVRIIVADGAEDVTIKISDEGGGIPRSGLSRIFTYLYSTA
ENPPDLDGHNEGVTMAGYGYGIPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEE
PLP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggagccggtggcgcgggcggtggcggaggaggtggcgcgctggggcgcgatg
cgccagaccggggtcagcctgcgctacatgatggagttcggggcgcgccccacggagcgg
accctccttctcgccgcgcagttcctgcacaaggagctccccatccgcatcgcgcgacgg
gcgctcgacctcgactcgctccccttcggcctctccaccaagcccgccatcctcaaggtg
aaagattggtatgtggagtcattccgtgaaatccggtcctttccagaggtgaggaaccag
aaagatgagctcgccttcacccagatgatcaaaatgatcagggtacgacacaccaatgtg
gtgcctgcgattgcattgggtgtgcagcagctgaagaaggacttgggcggtccaaaggcg
ttcccccccggaatccatgagatccatcagtttcttgaccgcttctacatgtcaaggatt
gggatccggatgctgatagggcagcacgtcgctttgcatgaccctgatccagagcctggt
gtgatagggcttataaacacaaaaatgtcacccatgacagttgctcgaattgctagtgaa
gatgcacgtgctatttgcatgcgggagtatggatcatctcctgatgtcgacatatatggt
gatccgggttttacatttccatatgttacaccacatctacatctcatgattttcgagctg
gtgaagaactcccttcgcgcggtacaggaacggtatatggattctgataagcttgcacct
ccagttcgaatcatagttgctgatggagcagaggatgtaactattaagattagtgatgaa
ggtggtggaataccaaggagtgggctctcaagaatttttacgtatctctatagtacagca
gaaaaccctcctgatctggacggacataatgaaggagtaactatggctggatatggttat
gggatccctattagtcgcctttatgctcgatatttcggtggggacttgcagatcatctct
atggaaggatatggaactgatgcttacctccacctttcacggctgggagattcggaggaa
cccttgccgtaa

DBGET integrated database retrieval system