KEGG   Zea mays (maize): 541707Help
Entry
541707            CDS       T01088                                 

Gene name
DRTS
Definition
(RefSeq) bifunctional dihydrofolate reductase-thymidylate synthase
  KO
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
zma  Zea mays (maize)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    541707 (DRTS)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    541707 (DRTS)
   00670 One carbon pool by folate
    541707 (DRTS)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     541707 (DRTS)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     541707 (DRTS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2
AA seq 523 aa AA seqDB search
MAMAAVLANGDSQGRPQRNYQVVVAGTRDMGIGKDGVLPWKLPGDLKFFKELTLITSDPV
KKNAVIMGRKTWESIPVKSRPLPGRLNVILTRSGSFDFATVENVVICGSMESALELLAST
PYCLSIEKVFVIGGGQVLREYLKGPACEAIHLTDIQSSIECDTFIPPVDFSVFQPWYSSF
PVIESNIRHSFVSFVRVRKSVAETHESNGKESTEVDTKNDKFETENFSFLPKMVYDRHEE
YQYLNLVEDIIRSGAQKNDRTGTGTLSKFGCQMRFNLRKNFPLLTTKRVFWRGVVEELLW
FISGSTNAKVLQEKGIHIWDGNASREYLNSVGLAHREEGDLGPIYGFQWRHFGAEYTDMH
ADYTGKGFDQLMDVIDKIKNDPDDRRIILSAWNPSDLKKMALPPCHMFAQFYVENGELSC
QMYQRSADMGLGVPFNIASYSLLTYMIAQVCDLSPGDFVHVIGDAHVYRNHVRALEEQIQ
KMPKPFPILKINPSKKDIDSFMASDFKLVGYDPHQKIEMKMAV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggccgcagttctggccaatggtgattcacagggtcgtcctcagaggaactat
caagttgttgttgctggcactcgtgacatgggcattgggaaggatggggtcttgccatgg
aagcttcctggtgatcttaaattctttaaagagcttacactaattacatctgatcctgtc
aaaaagaatgcagttataatgggaaggaaaacatgggagagcattccagttaagtcaagg
ccattgcctggtcgtttgaatgtcatacttactcgatctggtagttttgattttgcaaca
gtagagaatgttgttatctgtggaagtatggagtctgccttagaactgctagcatcaact
ccatattgcttatcaattgagaaagtgtttgttataggaggcgggcaggtactgagagaa
tatcttaaaggacctgcatgtgaggctatccatctaactgacattcagtcgagcattgag
tgtgacactttcatccctccggttgacttctcagtgttccagccatggtattcatctttc
ccggtgatagagagcaacattaggcattcgtttgtgtcttttgttcgtgttagaaagtca
gtggcagaaactcatgagtcaaatggcaaggaatcaaccgaggttgataccaagaatgac
aaatttgaaacagagaatttctcttttctccccaagatggtatatgaccgccatgaggag
taccaatatctcaatcttgttgaagatattataaggtctggtgctcagaaaaacgacagg
acaggaactggaacattgtcaaaatttgggtgtcagatgcggttcaacttaaggaaaaat
tttcctctgctgacaacaaagagggtattttggcgtggtgttgtcgaagaactcctttgg
ttcatcagtggctcaacaaatgcaaaggttttgcaagagaagggtattcatatctgggat
ggcaatgcttcaagagagtatctcaacagtgttggcttggcacacagggaggaaggtgat
ttaggtccaatttatggatttcagtggcgtcactttggtgctgaatacactgacatgcat
gctgactatacgggaaaaggttttgatcagctaatggatgtgattgacaagatcaagaat
gatcctgacgaccgtcgaataattttgtcggcgtggaatccttcagatctcaagaagatg
gctcttcctccttgccacatgtttgcacaattctatgtggaaaatggggagctatcttgc
cagatgtatcaacgctctgcagacatggggcttggtgttccattcaacatcgcatcatat
tctctcctgacatacatgattgctcaagtttgtgatctttctcctggagattttgtccat
gttataggggatgcccatgtctatagaaaccatgttcgagcactggaggagcaaattcag
aagatgcctaaaccatttccaattttgaagataaatccttcaaaaaaggatatagattct
tttatggcatcagacttcaagctggttggctatgacccccaccagaagatagagatgaaa
atggcagtgtaa

DBGET integrated database retrieval system