KEGG   Zea mays (maize): 541708Help
Entry
541708            CDS       T01088                                 

Gene name
eif7, eIFiso-4E
Definition
eucaryotic initiation factor7
Orthology
K03259  
translation initiation factor 4E
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    541708 (eif7)
Translation factors [BR:zma03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    541708 (eif7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 216 aa AA seqDB search
MAEVEAPATAVEAPAAAVATTTPEVAAPEAGAATEAKGPHKLHRQWTFWYDIQTKTKSGA
AWGTSLKKAYTFDTVEEFWSMYDQIFRPSKLSGNADFHLFKAGVEPKWEDPECANGGKWT
VPCNRKATFETMWLETLMALIGEQFDETEDICGIVASVRARGDKLALWTRTASNEAVQVN
IGKKWKDVIDYNDKITYTFHDDSKRDKPSRGGRYTV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtcgaggctccagctactgcggtcgaggctccagctgctgcggtcgcgacg
acgacccctgaggtggcggcgcccgaggccggagccgctacggaggcgaagggtccgcac
aagcttcaccggcagtggaccttctggtacgacatccagacgaagaccaagtccggggct
gcgtggggcacctccctcaaaaaggcctacaccttcgacaccgttgaggagttctggagc
atgtatgatcagatttttcgtccaagcaagttgtctgggaatgctgattttcatctattc
aaggctggagtagagccaaaatgggaagacccagagtgtgcaaatggtggcaaatggact
gtcccatgcaacagaaaggcaacctttgagaccatgtggcttgaaacgttgatggctctt
attggggagcagtttgatgaaacagaggacatttgtggaattgttgctagtgtccgtgca
agaggagataagctggcattatggactaggactgccagcaatgaagctgtccaggtaaac
attggcaagaagtggaaggatgtcatcgactacaacgacaagatcacgtacactttccat
gacgactctaagagagacaagcccagcagaggtgggcggtacaccgtgtaa

DBGET integrated database retrieval system