KEGG   Zea mays (maize): 541781Help
Entry
541781            CDS       T01088                                 

Definition
dihydrolipoamide S-acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    541781
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    541781
   00020 Citrate cycle (TCA cycle)
    541781
   00620 Pyruvate metabolism
    541781
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     541781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 542 aa AA seqDB search
MSAAQLLRHSRKLRSLQNPVGCENFSFVRHFSSGSGSFIARENGIGKRTRGTRFSQHNQP
AKQLETFSAGVNGSCTWRIASNSLTPSAASWLSGSFSCGQVVSARPFSSSADLPPHQEIG
MPSLSPTMTEGNIAKWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDGAK
EIKVGEVIAITVEEEGDIEKLKDYKPSSSAEPVAPAEPKAEPEPSQPKAEEKKPTQAPEA
KTPKIEEASQSGDRIFASPLARKLAEDNNVPLSSVKGTGPDGRILKADIEDYLASVAKGG
LRESFADPGLGYVDIPNAQIRKVTANRLLASKQTIPHYYLTVDARVDKLVQLRGELNPLQ
DASGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQYHNVNINVAVQTEHGLFVPVI
RDADKKGLGAIAEEVKQLAQKARDNSLKPADYEGGTFTVSNLGGPFGIKQFCAIINPPQS
AILAIGSAEKRVIPGSADGQFEFGSFMSATLSCDHRVIDGAIGAEFLKAFKGYIENPTSM
LL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgctcagcttctccgtcactcgcgcaagctgcggagtttgcaaaatcctgta
ggttgtgagaattttagttttgttcggcatttctccagcggttctgggtcctttatcgcc
agggaaaatggtattggaaaaagaaccagaggtaccagattttcccagcataaccagcct
gcaaaacagctcgagacattctcagcaggagtaaatggaagctgcacatggagaatagca
tccaacagccttaccccaagtgctgctagctggctcagtggttcattctcatgtggacag
gtagtctcagcacggccattctcaagtagtgcagacctgcctccacatcaagaaattggg
atgccgtctctttcacctacaatgactgagggaaacattgccaagtggcttaagaaggaa
ggagacaaggtctcccctggtgaggttctctgcgaagtggaaactgacaaagccactgtg
gagatggagtgcatggaagagggctatcttgctaagattattcatggagatggtgcgaag
gagattaaagttggtgaggtcattgctataactgtagaagaagagggtgacatcgagaag
ttgaaggattataagccgtcatcttcagctgaacctgtagctcctgctgaaccaaaggct
gaaccagaaccctcacagccgaaggcggaggaaaaaaagcctacgcaggctcctgaggcg
aagaccccgaagattgaagaagcttctcaatctggagatcgtatatttgccagccctctt
gcccgtaaattggctgaagataacaatgtcccactatcaagtgtgaaaggtactggtcct
gatggtcgtattttgaaggcagacattgaagattacttggcttctgtagccaagggtggg
ctgagggagtcttttgcagatccagggttaggttatgttgatattccaaatgcacagata
agaaaggttactgcaaatcgcttgctagcatcgaaacagaccattcctcattactacttg
acagtagatgcacgtgttgacaaacttgtccagttgcgaggtgaactgaacccactgcag
gatgcttctggtggaaagaaaatatcaattaatgatcttgtcatcaaggctgcagctttg
gcccttcgaaaggtccctcagtgtaacagctcatggatgaatgattttattcggcaatac
cacaatgtgaacatcaacgtggctgtacagactgaacatggattgtttgttccagtaatt
agggatgcagacaagaagggactcggtgcaattgctgaggaggtgaagcagttggctcaa
aaagcaagagataatagcctaaaaccagcagattacgagggcggcaccttcactgtatca
aatttgggaggtcccttcggaattaaacaattctgcgccatcataaatcctccccagtca
gcaattttggccattggttctgctgagaagagggtgatacctggttccgctgatggccag
tttgaatttggttcattcatgtcagctacactgagctgtgaccacagggttatagatggc
gcaatcggtgcggaatttctgaaagcattcaagggatacatcgagaacccaacttcaatg
ctgctgtga

DBGET integrated database retrieval system