KEGG   Zea mays (maize): 541855Help
Entry
541855            CDS       T01088                                 

Gene name
igl1, TSAlike
Definition
indole-3-glycerol phosphate lyase1
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zma  Zea mays (maize)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:zma01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:zma00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:zma00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 274 aa AA seqDB search
MANGGAAAGKLTVAETFSNLREQGKSAFIPFITAGDPDLVTTSKALKILNSCGSDVIEVG
VPYSDPLADGPVIQASATRALKKGTTLDSVIEMLKGVTPELSCPIVLFTYYNPILKRGVG
NFMSTIKQAGIHGLVVPDLPLEETTLLRSEAIMHNIELVLLTTPTTPTDRMKGIAQASEG
FLYLVSAVGVTGARSNVNLRVEHLLREIKKVTDKPVAVGFGVSTPEHVKQIVGWGADGVI
VGSAIVKQLCEAATPEEGLERLEEYARSMKAAMP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggccaacggcggcgctgcggccggcaagctcaccgtcgccgagaccttctccaacctc
agggagcaaggcaagagtgcattcatcccgttcataactgctggtgatcctgacctggta
accacatcgaaagcattgaagattctcaattcctgcggttcggatgttatagaggttggc
gtaccatactcggatccactggctgatgggccagttattcaggcttctgcaacacgggcg
cttaagaaaggcactacacttgattctgtcatagagatgctgaagggggttacacctgag
ctttcttgccccattgttcttttcacatactataatccaattctgaaacgtggtgtggga
aacttcatgtctactatcaaacaagctggcatacatggacttgtagtgcctgatcttcct
ttggaggagacgacgttgctgaggagcgaggccattatgcacaacatagagctggtgctg
cttacaacgccaaccacgccgacagatcggatgaagggaattgcacaagcttcagaagga
tttctctatcttgtgagcgctgtaggggttacaggtgcacgctcaaatgtaaacttacgt
gtagaacaccttcttagggagatcaagaaggttacagacaaaccggtagctgttggtttc
ggtgtatcgactccagagcatgtgaaacagatcgtgggctggggagcggacggtgtgatt
gttggcagtgcgattgtgaagcagttgtgtgaggctgctactcctgaagagggtctggaa
aggctcgaggagtacgccaggagtatgaaggctgctatgccgtga

DBGET integrated database retrieval system