KEGG   Zea mays (maize): 541866Help
Entry
541866            CDS       T01088                                 

Gene name
prpo2
Definition
protoporphyrinogen IX oxidase (mitochondrial)2
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
zma  Zea mays (maize)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    541866 (prpo2)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     541866 (prpo2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 544 aa AA seqDB search
MLALTASASSASSHPYRHASAHTRRPRLRAVLAMAGSDDPRAAPARSVAVVGAGVSGLAA
AYRLRQSGVNVTVFEAADRAGGKIRTNSEGGFVWDEGANTMTEGEWEASRLIDDLGLQDK
QQYPNSQHKRYIVKDGAPALIPSDPISLMKSSVLSTKSKIALFFEPFLYKKANTRNSGKV
SEEHLSESVGSFCERHFGREVVDYFVDPFVAGTSAGDPESLSIRHAFPALWNLERKYGSV
IVGAILSKLAAKGDPVKTRHDSSGKRRNRRVSFSFHGGMQSLINALHNEVGDDNVKLGTE
VLSLACTFDGVPALGRWSISVDSKDSGDKDLASNQTFDAVIMTAPLSNVRRMKFTKGGAP
VVLDFLPKMDYLPLSLMVTAFKKDDVKKPLEGFGVLIPYKEQQKHGLKTLGTLFSSMMFP
DRAPDDQYLYTTFVGGSHNRDLAGAPTSILKQLVTSDLKKLLGVEGQPTFVKHVYWGNAF
PLYGHDYSSVLEAIEKMEKNLPGFFYAGNSKDGLAVGSVIASGSKAADLAISYLESHTKH
NNSH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctttgactgcctcagcctcatccgcttcgtcccatccttatcgccacgcctcc
gcgcacactcgtcgcccccgcctacgtgcggtcctcgcgatggcgggctccgacgacccc
cgtgcagcgcccgccagatcggtcgccgtcgtcggcgccggggtcagcgggctcgcggcg
gcgtacaggctcagacagagcggcgtgaacgtaacggtgttcgaagcggccgacagggcg
ggaggaaagatacggaccaattccgagggcgggtttgtctgggatgaaggagctaacacc
atgacagaaggtgaatgggaggccagtagactgattgatgatcttggtctacaagacaaa
cagcagtatcctaactcccaacacaagcgttacattgtcaaagatggagcaccagcactg
attccttcggatcccatttcgctaatgaaaagcagtgttctttcgacaaaatcaaagatt
gcgttattttttgaaccatttctctacaagaaagctaacacaagaaactctggaaaagtg
tctgaggagcacttgagtgagagtgttgggagcttctgtgaacgccactttggaagagaa
gttgttgactattttgttgatccatttgtagctggaacaagtgcaggagatccagagtca
ctatctattcgtcatgcattcccagcattgtggaatttggaaagaaagtatggttcagtt
attgttggtgccatcttgtctaagctagcagctaaaggtgatccagtaaagacaagacat
gattcatcagggaaaagaaggaatagacgagtgtcgttttcatttcatggtggaatgcag
tcactaataaatgcacttcacaatgaagttggagatgataatgtgaagcttggtacagaa
gtgttgtcattggcatgtacatttgatggagttcctgcactaggcaggtggtcaatttct
gttgattcgaaggatagcggtgacaaggaccttgctagtaaccaaacctttgatgctgtt
ataatgacagctccattgtcaaatgtccggaggatgaagttcaccaaaggtggagctccg
gttgttcttgactttcttcctaagatggattatctaccactatctctcatggtgactgct
tttaagaaggatgatgtcaagaaacctctggaaggatttggggtcttaataccttacaag
gaacagcaaaaacatggtctgaaaacccttgggactctcttttcctcaatgatgttccca
gatcgagctcctgatgaccaatatttatatacaacatttgttgggggtagccacaataga
gatcttgctggagctccaacgtctattctgaaacaacttgtgacctctgaccttaaaaaa
ctcttgggcgtagaggggcaaccaacttttgtcaagcatgtatactggggaaatgctttt
cctttgtatggccatgattatagttctgtattggaagctatagaaaagatggagaaaaac
cttccagggttcttctacgcaggaaatagcaaggatgggcttgctgttggaagtgttata
gcttcaggaagcaaggctgctgaccttgcaatctcatatcttgaatctcacaccaagcat
aataattcacattga

  All links  
No link information was found.   
DBGET integrated database retrieval system