KEGG   Zea mays (maize): 541950Help
Entry
541950            CDS       T01088                                 

Gene name
ham101, hac108
Definition
histone acetyl transferase MYST family 101
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     541950 (ham101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 444 aa AA seqDB search
MGSMEASTAPENGSSAAGGGAGGTACNGAGAASNGGGMERRLRSSAASASWAAHLPLEVG
TRVMCRWRDQKLHPVKVIERRKGSACSSPADYEYYVHYTEFNRRLDEWVKLDQLDLDTVE
TVVDEKVEDKATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIAKIELGR
YEIDTWYFSPFPPEYNDCPKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTL
SMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEK
HSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWT
RVLLEILKKHKGNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHL
KAAGRGGLDVDVSKLIWTPYKEQG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgggctccatggaagcgtcgaccgcgccggagaacggctcctccgctgccggtggcgga
gccggcggcacggcgtgcaacggggcgggcgccgcgtctaacggaggaggcatggagagg
cggctgaggtcctcggccgcgtccgcgtcgtgggcggcgcaccttcccctggaggtgggc
acgcgcgtgatgtgccggtggcgcgaccagaagctccacccggtcaaggtgatcgagcgc
cgcaagggctccgcgtgctcttcccccgccgactacgagtattacgtccactacaccgag
ttcaatagaagacttgacgagtgggttaagcttgatcagcttgatcttgacactgtcgag
accgttgtcgatgagaaagtagaagataaggcaacaagcttaaagatgacacggcaccag
aaacgtaaaattgatgaaacacatgtggagcaaggacatgaggagcttgatgcagccagc
ttgcgggaacatgaagaattcacaaaggtgaaaaatatcgcgaagatcgaactggggaga
tatgagatagacacatggtatttctctccttttccaccagagtataatgactgcccgaag
ctgtttttctgtgaattttgcctcaacttcatgaagcgcaaagaacagcttcagaggcac
atgaagaagtgtgatcttaagcaccccccaggtgatgaaatctatagaagtggaactcta
tcaatgttcgaggttgatgggaagaagaacaaggtttatggacagaacctttgttatctg
gctaagctatttcttgatcacaagacattgtactatgatgttgatttgttcttgttttat
gtcctctgcgaatgtgatgatcggggatgtcatatggtgggatatttctctaaggaaaaa
cactccgaagaatcttataatttggcttgcattctcactctccccccataccaaagaaaa
ggatatgggaagttcctgattgctttctcatatgaactttccaagaaagaaggtaaagtt
gggacaccggagcgccctctctctgatcttggtctgctcagctatagaggttattggact
agagtgcttctggaaattctaaagaaacataagggaaacatatctataaaggaactaagc
gacatgacggcaataaaagcagatgacatattgagcacgctacagagcctggacctaatc
cagtaccgcaaagggcagcacgtcatctgcgctgacccgaaggtcctcgaccgccacctc
aaggcggcggggcggggcggcctggacgtcgacgttagcaagctcatatggactccctac
aaggagcaaggctaa

DBGET integrated database retrieval system