KEGG   Zea mays (maize): 541953Help
Entry
541953            CDS       T01088                                 

Gene name
hda102
Definition
histone deacetylase (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     541953 (hda102)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 430 aa AA seqDB search
MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHQKMEIYRPHKAYPIEL
AQFHSADYVEFLHRITPDSQHLYASELTRYNLGEDCPVFDNLFEFCQIYAGGTLDAARRL
NHKICDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKYGDLFFPGTGDIKDIGEREGKYYAINIPLKDGIDDTSFTRLFKT
IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY
TKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK
VQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHRDDEYYEGD
NDNDHDDGTR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaaagaccggatatcctacttctacgacggagatgttggcaatgtctacttt
gggccaaatcaccccatgaagccacatcgtctctgtatgacacatcaccttgttctttca
tatggacttcatcaaaagatggagatatatagaccacacaaagcatatccaatagagctt
gcccaattccattctgctgattatgtggaattcttgcaccggataactcctgattcccag
cacctatatgcaagtgaactaactagatacaatcttggagaagactgtccggtctttgat
aatttgtttgagttctgccaaatctatgcgggaggaactttagatgctgctcgcagatta
aatcataaaatatgtgacattgccattaattgggctggtgggctacatcatgccaaaaag
tgtgaggcttcaggcttctgttacattaatgatctagtattaggaattctggagcttctc
aagtaccatgccagggttctttatattgacattgatgtccatcatggagatggagttgaa
gaagccttttatttcactgacagggtaatgactgtgagtttccacaagtatggtgacctg
ttctttcctggaacaggtgatattaaagatataggagaaagggaaggaaaatattatgcc
atcaacattccacttaaagatgggatagatgacactagctttactcggctttttaaaaca
attattgccaaagttgttgagacatatctgcctggtgctattgttcttcaatgtggggct
gattcattggcgagggatcgtttaggctgcttcaatctctctattgaaggtcatgctgaa
tgtgtaaagtttgtcaagaaattcaatattccccttctggtaactggaggtggtggatac
accaaggagaatgtagcacggtgttgggctgttgaaactggggtccttttagacacagaa
ctcccaaatgagattccaaaaaatgaatatattgagtactttgctccagattatacattg
aaagttccaaatttgaacatggacaatttgaacagtaagacctatctcagttcaatcaaa
gtgcaagtgatggagagtttgcggtacatacagcatgctcctggtgttcaaatgcaagag
gttcctcccgatttttatatcccggactttgatgaagatgaattggatcctgatgaacgt
gttgaccagcacactcaagacaagcagattcaccgtgatgatgagtactatgaaggtgac
aatgacaacgatcacgacgacggcacacgctaa

DBGET integrated database retrieval system