KEGG   Zea mays (maize): 541980Help
Entry
541980            CDS       T01088                                 

Gene name
sdg113, set113
Definition
LOC541980
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
zma  Zea mays (maize)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    541980 (sdg113)
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     541980 (sdg113)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 766 aa AA seqDB search
MNGPSNFMPTPEQDVLDVKPLRTLAPMFPAPLGVNTFNHSTTPPLIFVTPSGQFQGGFGD
WNNSAAKSFFAFSSKDARGGKADTFSDQNTGTGKAATFGDQDAFGSQNVFASDHSTGTGK
AATFGDQDAFGSQNVATGVQDAAKGQTATDWTDVSANPNGPIDAIAISAYRSTQPNVISL
DDDDDDDDDEPYAANKTSASGRKIKRPSHLSGYNVSDALVSDSSNSMKVKRPKSSHGKAA
ADNEHALLPPSEDPREIVEAVLMTFEALRRRHLQLDEAQETSKRADLKASAILMSSNIRA
NPGKRIGVVPGVEIGDIFYFRMELCIIGLHAPSMAGIDYMTAKFGDEDDSVAICIVAAGG
YDNNDDDTDVLVYSGSGGNSKNSEEKHDQKLERGNLALERSLSRKNVIRVVRGYKDPGCL
TGKVYIYDGLYRIHESWKEKTKSGIFCFKYKLLREPGQPDGVAIWKMSQKWVQNPLTRGS
VLNPDLSSGAENLPVCLVNDIDSDEVPHHFTYTTQVEHLKPLSSVKPLQGCRCLSVCLPG
DANCCCAQRNGGSLPYSSSGLLVCRKTMVYECGESCRCSFNCRNRVTQKGVRIHFEVFKT
GNRGWGLRSWDAIRAGSFICEYVGEVIDDANINLNDIEDDYIFQMSCPGERTLKWNFGPE
LIGEQSTNVSADTFETLPIKISAKRIGNISRFMNHSCAPNVFWQPVQFDHEDDHRPHIMF
FALKHIPPMTELTYDYGDVGADPSGVRSPRAKNCLCESSNCRGFFI
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtccatcgaatttcatgcctactcctgaacaggatgttctggacgtcaagccc
ttgaggacattggctccaatgttccctgctcctctgggtgtcaatacatttaaccactca
accacgccaccattgatatttgtcactccttctggacaatttcaagggggttttggtgat
tggaataattctgctgccaaatcatttttcgctttcagcagcaaggatgctcgtggaggc
aaggctgatacatttagtgatcagaatactggtactggcaaggctgccacttttggtgat
caggatgcttttggcagccagaatgtttttgctagtgatcacagtactggtactggcaag
gctgccacttttggtgatcaggatgcttttggcagccagaatgtcgccactggtgtgcag
gatgctgcgaaaggccagactgcaacagattggacagatgtgagtgccaatcctaatggc
ccaattgatgccattgccatttcagcttacaggtcaacacagcctaatgttatatcactg
gatgatgatgatgacgacgacgatgatgagccttatgctgctaacaagacatcagcatct
ggacgcaagatcaagaggccatcccacctcagcggatacaatgtgagtgatgctttggta
agtgacagctccaacagcatgaaggttaagcgccccaaatcctctcacgggaaagctgct
gctgacaacgagcatgccttgcttccaccttctgaggatcccagggaaattgtggaggca
gttctcatgacctttgaggcgttgcggcgtaggcatctccaattggatgaggcacaagag
actagcaagcgtgcagatctgaaggctagtgctatcttgatgtccagtaatatcagggct
aaccctgggaagaggataggggttgttcctggagttgaaataggggacattttctacttc
aggatggagctatgtattattgggctgcatgctcctagcatggccggaattgactatatg
actgccaagtttggtgacgaggatgattctgttgcaatatgtattgttgctgcaggtggt
tatgacaataatgatgatgatacagatgtactggtttacagtggttcaggaggtaatagc
aagaacagtgaggagaagcatgaccagaagcttgagaggggcaacctggctcttgagagg
agcttgtccagaaaaaatgtaatccgtgtggttcggggctataaggatccaggttgcttg
actgggaaggtttatatttatgatggcctctataggattcacgagtcatggaaggagaaa
acgaagagtggaatattttgttttaagtacaagctgctgcgagagccaggacaacctgat
ggggttgcaatctggaagatgtcccagaaatgggtacaaaatccactgactagaggcagt
gttttaaatcctgatctatcatctggtgcagaaaatcttccagtgtgtcttgttaatgac
attgacagtgatgaagtgccacaccatttcacatataccactcaggtcgaacacttgaaa
ccactcagttctgtgaagcctttacagggttgcagatgccttagtgtttgtctgcctggt
gatgccaactgctgctgtgcacagcgtaatggaggcagcttaccttacagctcatcagga
ctgcttgtatgccgcaagactatggtttatgaatgtggtgaatcctgtcggtgttctttc
aattgtcgtaacagagtgacccagaaaggagttaggatccactttgaggtctttaagacg
ggaaatcgaggctggggtcttcgttcgtgggacgctatacgggctggttcatttatatgc
gagtatgttggtgaggttattgatgatgctaacattaatctgaatgatattgaagatgat
tatatatttcagatgtcgtgtcctggtgagaggacattaaaatggaattttggacctgaa
ttgataggggagcaaagcacaaatgtttctgctgatacctttgagactctacccattaag
ataagtgctaaaagaataggaaacatatcacgtttcatgaaccatagttgtgctcctaac
gtattttggcagccagttcagtttgaccatgaagatgatcatcgcccacatatcatgttc
tttgctttgaagcatattcctcccatgacagagttgacttatgactatggtgacgttgga
gctgatcctagtggtgtacggtctcctagagcaaagaactgcctttgtgaatcctcaaat
tgtcggggattctttatctga

DBGET integrated database retrieval system