KEGG   Zea mays (maize): 542023Help
Entry
542023            CDS       T01088                                 

Gene name
IDP154, dxr
Definition
dxr protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
zma  Zea mays (maize)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    542023 (IDP154)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     542023 (IDP154)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 472 aa AA seqDB search
MAALKASFRGELSAASFLDSSRGPLVQHKVDFTFQRKGKRAISLRRTCCSMQQAPPPAWP
GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV
KTFKPKLVAVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG
LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG
ALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGRKITVDSATLFNKGLEVIEAH
YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVT
WPRLDLCKLGSLTFRAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVELFIDEKISY
LDIFKVVELTCNAHRNELVTSPSLEEIVHYDLWARRYAASLQPSSGLSPVPA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggctgcactcaaggcatcgttccggggtgagctcagcgccgcttccttcctcgactcc
agcaggggacctctcgtccagcacaaagtggattttacgtttcaaaggaagggcaaacga
gctatttcactgagaaggacatgctgttctatgcaacaggctccaccaccagcatggcct
gggcgagctgttgctgagcctggccggaggtcatgggatggcccaaagcctatctcgatt
gttggttcaactggttccataggaacacagacattggacattgttgcggagaatcctgat
aagttcagagttgttgctcttgctgctggatccaatgtcacgcttctagctgatcaggtc
aaaacattcaaacctaagttggttgctgtaagaaacgaatcattagttgatgaattgaaa
gaagccttggctgattgcgaagagaagccagaaattattcctggggagcaaggtgtcata
gaagttgctcgccatccagatgcagttacagttgtcacagggatagtaggttgtgcaggg
ctgaagcctacagttgctgcaattgaagctggtaaagacatagcattggcaaacaaagag
acacttattgcaggtggtccttttgtgcttccccttgcacacaaacacaaagtgaaaatt
cttccagctgattctgagcactctgcaatatttcagtgtatacaaggcttgtccgaaggt
gcacttcgtcgcattattctaactgcatcaggtggtgctttcagggactggccagttgac
aggctgaaagatgtaaaagttgctgacgctttaaagcatccaaactggaatatgggaagg
aagatcacagtagattctgctactttattcaacaagggtttagaagttattgaagcacat
tatttatttggtgctgaatatgatgacattgagattgtgattcacccacagtctatcata
cactctatggttgaaacccaggattcatctgtcctagctcagttgggatggccagatatg
cggttaccaatcttatacaccttatcatggccagatagaatctattgctctgaggtcacc
tggccccgtctggatctttgcaagttgggttcactgacattcagagctccagacaacgta
aaatacccatcaatggacctagcctatgcagctggccgcgctgggggcaccatgacagga
gtcctgagcgctgctaatgagaaggccgtggagttgttcattgacgagaagattagctac
ctggacatattcaaggtggtggagcttacatgtaacgcgcatcggaacgagctggtaaca
agcccgtcactggaggagatcgtccattacgatctgtgggcgaggagatatgcagccagt
ctacaaccatcttctggcctgagccctgtccctgcataa

DBGET integrated database retrieval system