KEGG   Zea mays (maize): 542023Help
Entry
542023            CDS       T01088                                 

Gene name
IDP154
Definition
(RefSeq) dxr protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
zma  Zea mays (maize)
Pathway
zma00900  Terpenoid backbone biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Module
zma_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    542023 (IDP154)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     542023 (IDP154)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 542023
NCBI-ProteinID: NP_001105139
UniProt: Q9FXZ7
Position
3
AA seq 472 aa AA seqDB search
MAALKASFRGELSAASFLDSSRGPLVQHKVDFTFQRKGKRAISLRRTCCSMQQAPPPAWP
GRAVAEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQV
KTFKPKLVAVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAG
LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEG
ALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGRKITVDSATLFNKGLEVIEAH
YLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVT
WPRLDLCKLGSLTFRAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVELFIDEKISY
LDIFKVVELTCNAHRNELVTSPSLEEIVHYDLWARRYAASLQPSSGLSPVPA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggctgcactcaaggcatcgttccggggtgagctcagcgccgcttccttcctcgactcc
agcaggggacctctcgtccagcacaaagtggattttacgtttcaaaggaagggcaaacga
gctatttcactgagaaggacatgctgttctatgcaacaggctccaccaccagcatggcct
gggcgagctgttgctgagcctggccggaggtcatgggatggcccaaagcctatctcgatt
gttggttcaactggttccataggaacacagacattggacattgttgcggagaatcctgat
aagttcagagttgttgctcttgctgctggatccaatgtcacgcttctagctgatcaggtc
aaaacattcaaacctaagttggttgctgtaagaaacgaatcattagttgatgaattgaaa
gaagccttggctgattgcgaagagaagccagaaattattcctggggagcaaggtgtcata
gaagttgctcgccatccagatgcagttacagttgtcacagggatagtaggttgtgcaggg
ctgaagcctacagttgctgcaattgaagctggtaaagacatagcattggcaaacaaagag
acacttattgcaggtggtccttttgtgcttccccttgcacacaaacacaaagtgaaaatt
cttccagctgattctgagcactctgcaatatttcagtgtatacaaggcttgtccgaaggt
gcacttcgtcgcattattctaactgcatcaggtggtgctttcagggactggccagttgac
aggctgaaagatgtaaaagttgctgacgctttaaagcatccaaactggaatatgggaagg
aagatcacagtagattctgctactttattcaacaagggtttagaagttattgaagcacat
tatttatttggtgctgaatatgatgacattgagattgtgattcacccacagtctatcata
cactctatggttgaaacccaggattcatctgtcctagctcagttgggatggccagatatg
cggttaccaatcttatacaccttatcatggccagatagaatctattgctctgaggtcacc
tggccccgtctggatctttgcaagttgggttcactgacattcagagctccagacaacgta
aaatacccatcaatggacctagcctatgcagctggccgcgctgggggcaccatgacagga
gtcctgagcgctgctaatgagaaggccgtggagttgttcattgacgagaagattagctac
ctggacatattcaaggtggtggagcttacatgtaacgcgcatcggaacgagctggtaaca
agcccgtcactggaggagatcgtccattacgatctgtgggcgaggagatatgcagccagt
ctacaaccatcttctggcctgagccctgtccctgcataa

DBGET integrated database retrieval system