KEGG   Zea mays (maize): 542083Help
Entry
542083            CDS       T01088                                 

Gene name
hat1, hac106
Definition
histone acetyltransferase1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     542083 (hat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 468 aa AA seqDB search
MALKQKDTDAAATATGTKKRRRVFFSDTDAGVEANECMKVFLVWNPGEVSSVDCTAIQPF
DLNHFFGEDGKIYGYKNLKINVWISAKSFHGYADVSFDETSDGGKGITDLKPVLQNIFGE
NLVEKEEFLHTFSKECEYIRTAVTNGSAIKHDGSYESDPAVEIVRVELQGAAAFLYSRLV
PLVLLLVEGSTPIDIGEHGWEMLLVVKKATQEAGSKFELLGFAAVHNFYHYPESIRLRIS
QILVLPPYQGEGHGLGLLEAINYIAQSENIYDVTIESPSDYLQYVRSSIDCLRLLMFDPI
KPALGAIVLSLKETNLSKRAQSLRMVPPADLMETVRQKLKINKKQFLRCWEILIFLSLDS
QDHKSMDNFRACIYDRMKGEILGSASGTNRKRLLQMPTSFNKEASFAVYWTQEIEDEDEQ
TVEQQPEDLKTQEQQLNELVDIQIEEIAGVAKNVTSRCKDKMTELVVQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaagcagaaggacaccgacgccgccgccaccgccaccggtaccaagaagcgc
cgccgcgtcttcttctccgacaccgatgctggtgttgaggcaaatgagtgtatgaaagtg
tttctagtatggaatccaggcgaggtgagctctgtagactgcactgctattcagccattt
gacctaaaccatttttttggtgaagatggaaaaatatatggttacaaaaatcttaagata
aatgtgtggataagtgcgaaatctttccatggatatgctgatgtttcatttgacgaaaca
tctgatggagggaaaggaataacagatctaaagcctgttcttcagaacatttttggagaa
aacttggtagaaaaagaggaattcctgcatacattttcgaaggaatgtgaatatatcaga
actgcagtgacaaatggtagtgccattaagcatgatggctcatatgaatcagatcctgca
gttgagattgttcgagttgaactccaaggtgctgctgcatttctttattctcgtctggta
cctcttgttcttcttctggttgaaggttccacgcctatagatattggagaacatggatgg
gaaatgcttctggtagtaaagaaggcaacacaagaggctggttcaaaatttgaactgcta
ggttttgcagctgtgcataacttctatcattatcctgagagtattcgcttacgaatcagc
cagatacttgtgttgccaccttatcagggtgaaggccatggtcttggtcttcttgaagca
atcaattatattgcacagtctgagaacatttacgatgttacaatagaaagcccttctgat
tacctgcagtatgtgcgatcatccattgactgcctccgtttgctcatgtttgatccgatc
aaacctgcactcggtgctattgtcttgtctctgaaggagaccaacctgtcaaaaagggcc
caaagtttgagaatggttccaccagctgacctgatggagactgtccgtcagaagctgaag
ataaacaagaaacagttcctccggtgctgggaaattctgatcttcctaagcctcgactct
caggatcataagagcatggacaacttcagggcctgcatatatgaccgcatgaagggggag
atccttggcagtgcctctggaactaacaggaagcgtctgttgcagatgccaaccagtttc
aataaggaggcatcttttgctgtgtattggacacaggagattgaggatgaggatgaacaa
actgttgagcagcagccagaggatctcaagacgcaggagcaacagctcaatgagctcgtg
gacatccaaatcgaggagattgctggggtcgccaagaacgtcacttcacgttgcaaggat
aagatgacagagctggtggttcaatga

DBGET integrated database retrieval system