KEGG   Zea mays (maize): 542211Help
Entry
542211            CDS       T01088                                 

Gene name
cl3114_1(600), TOR, ZmTOR
Definition
LOC542211
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
zma  Zea mays (maize)
Brite
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   542211 (cl3114_1(600))
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
6
AA seq 2464 aa AA seqDB search
MKPSPHFPEIGKKPKDLIAKDHTFNIAAYISSGADVIAAALRKHVEEEARDLSGEAFLRF
MDQLYEQISSLLQSNDVNENLLALRAIDALIDMPFGEGASKVSKFASFLRNVFEVKRDPE
ILVPASEVLGHLAKAGGAMTADEVERQIKTALGWLTGERVEYRRFAAVLILKEMAENAST
VFNVHVPEFVDAIWVALRDPKQAVREKAVEALRACLHVIEKRETRWRVQWYYRMCEAAQV
GLGRNASVHSIHGSLLAVGELLRNTGEFMMSRYREVADIVLDYLKHRDQLVRRSITSLLP
RIAHFLRDRFVTNYLKICMDHILFVLRTPDERASGFVALGEMAGALGVELVPYLPAITSH
LQDAIAPRRGRPSLEAISCVGSFAKAMGPAMEPHIRSGLLDAMFFAGLSDKLIDALESIS
TSIPSLLPTIQERLLDCISQALPKSSIRPGASVGRASRSNNLQQFVDSNSPVLVQLALWT
LANFNFKGHELLEFARESVILYLEDEDSSTRKAASLCCCKLVAHSLSASSASQFGSNRTN
RIGGAKRRRLVEEIVEKLLMAAVADADVGVRSSVFKALYRNPAFDDFLAQADILTSIFVA
LNDEEYDVRELAISVAGRLSEKNPAYVLPALRRYLIQLLTYLDQSMDSKCREESARLLGC
LIRSCARLILPYIAPVHKALVTRLCEGTGPNANNALAAGVLATVGELAKVGGFAMRQYLP
ELMPVVVDSLLDGGAVSKREVAVSTLGQIIQSTGYVIAPYNEYPPLLGLLLKLLNGELEW
STRLEVLKVLGIMGALDPHAHKRNQHNLPGQHREVLRPTSKPHNILFPWKNLPTDYWPSF
QHPRTTIQQLQLAPSCEFFEILLFQVITKWWLAPLSLFLSQWALAVFPYLPKVLPDLFRA
VRMCEDGALKEFITWKLGTLISIVRQHIRKYLQDILSLISELWTSSFSLAAPNRTIQGPQ
GSPVLHLVEQLCLALNDEFRMYLLHILPSCIQVLGDAERCNDYYYVPDILHTLEVFGGNL
DEHMHLVAPVLVRLFKVELVDIRRRAIVTLTNLIPKVQVGTHVSALVHHLKLVLDGNNDD
LRKDAAEALCCLALGEDFTIFIPSIRKILVKHHLRYRKWDEIENRLLRRELLITENLSVQ
KYTQCPPDVISDPLDDCDGTPSEIADETQRQARSHQVNDVRLRSAGEASQRSTREDWAEW
MRHFSIALLKESPSPALRTCARLAQLQPSVGRELFAAGFASCWAQMSESSQEQLVRSLKT
AFSSQNIPPEILATLLNLAEFMEHDEKPLPIDTRLLGALAEKCRAFAKALHYKEMEFEAV
CTKKMGANPVTVVESLIHINNQLQQHEAAIGILTYSQQNSEVQLKESWYEKLHRWDEALK
AYTVKSSQTSGPLQNLDATLGRMRCLAALARWEDLSALCREQWTGAEPSARLEMAPMAAN
AAWHMGEWDHMADYVSRLDDADENKLRMLGNATASGDGSSNGAFFRAVLLVRYKKYDDAR
MYVERARRCLATELAALVLESYERAYNNMVRVQQLSELEEVIDYCTLPMESPIADGRREL
IRNMWNERIKGTKRNVEVWQALLAVRELVLPPNEDRDTWIKFAELCWKNGRISQARSTLV
KLLQFDPESSPELTLYHAHPQVALAYLKYQYAVGDELKRRDAFSKLQELSVQVATTMGNL
PGTSANHGTMSNAGVPLIARVYLTLGSWKKALSPALDDDSIQEILISYHNATLSAKDWGK
AWHIWALFNTEVMSRYTFRGRPDIAGKYVVAAVTGYFYSIACASTTKGVDDSLQDILRLL
TLWFNHGDTSEVQTALQKGFSLVKIEMWLVVLPQIIARIHSNNRVVRELIQSLLVRIGKG
HPQALMYPLLVACKSISILRQRAAQEVVDKIRQHSGGLVDQAQLVSKELIRVAILWHEMW
HEALEEASRMYFGEHNIEGMLAVLEPLHAMLERGDETIKENAFIQAYGHELLEAHECCLK
YRATGEDAELTKAWDLYYHVFRRIDKQLPSLTTLDLHSVSPELLKCRKLELAVPGTYAAD
SPLVTIEYFVPQLIVITSKQRPRKLTIHGSDGNDYAFLLKGHEDLRQDERVMQLFGLVNT
LLENSRKTSEKDLSIQRYAVIPLSPNSGLIGWVPNCDTLHALIREYRDARKIFLNQEHRL
MLAFAPDYDHLPLIAKVEVFQHALQNTEGNDLAKVLWLKSRTSEVWLERRTNYARSLAVM
SMVGYLLGLGDRHPSNLMLDRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAM
EVSGIEGTFRTTCENVMQVLRTNRDSVMAMMEAFVHDPLINWRLFNFNEVPQVSNYGNVH
AHTVVSSEEAVANRELMQPQRGARERELLQAVNQLGDANEVLNERAVAVMARMSDKLTGR
DFSSGSALAGAGSSIQHGSEHLASGDARDAQPGLSVKVQVQKLILQATSHENLCQNYVGW
CPFW
NT seq 7395 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctcgccgcacttcccggagatcggaaagaagcctaaagatttgattgctaag
gaccacacatttaacatcgcggcttacatctcgtctggagcggatgttattgctgccgcg
ctccgtaaacatgttgaggaggaagcccgagatctcagcggtgaagcttttttaaggttt
atggatcagctctatgagcagatatctagtttactgcagagcaacgatgttaatgaaaat
ttactggctctccgtgctatcgatgcgttaattgatatgccctttggagaaggcgcttcc
aaagtttctaagtttgccagcttcttgagaaacgtatttgaagtgaagcgcgaccctgaa
atcctagttcccgcaagtgaagtgctgggtcatttagcaaaagcgggaggagcaatgact
gcagatgaagtggagcggcagattaaaacggctttggggtggcttactggtgaacgagtg
gaatatcgccgatttgcagctgtactcattctcaaagagatggcagaaaatgcgtcaaca
gttttcaatgttcatgttcctgagtttgttgatgctatatgggtagcactgagagaccct
aaacaagctgttcgtgaaaaagcagttgaagccttgcgcgcttgtctccatgttattgaa
aaacgggagacacgttggcgtgtacaatggtattaccggatgtgtgaagccgcacaagtt
gggcttggcaggaatgcttctgttcatagtattcatggatcattattggccgttggagaa
ttgctgaggaatacaggggagtttatgatgtctcggtacagagaagtggctgatattgtc
ctcgattatttaaagcatcgagatcagcttgttcgacgtagtataacatcacttcttcct
cgaattgcccacttcctgcgtgacagatttgtgactaattacctgaagatttgtatggat
catatcttgtttgttctacgtacaccagacgagcgcgctagtggttttgttgcccttgga
gagatggctggggctctgggtgttgaacttgtgccttatttaccagcaattacctcacat
ttgcaagatgcgattgctcctcgcagaggaaggccatctcttgaggcaatttcttgtgta
ggaagctttgcaaaagctatgggtcctgcaatggaacctcatattcgtagcggacttcta
gatgctatgttttttgctggtctttctgataaacttatagatgcactcgagtctataagc
acaagcatcccgtctttactacccacaatacaggagcgtttattggattgtatatctcaa
gcactaccaaagtcatcaataaggccaggtgcttctgttggtcgagcaagcaggtcaaac
aatttgcaacagtttgtggactctaatagtcctgttcttgtgcaacttgcactgtggact
ctagcaaacttcaactttaagggccatgaacttctggaattcgctagagagagtgtcata
ctttatttggaagatgaagatagcagtaccagaaaagctgcctctttgtgctgttgcaaa
ttagttgcacactccctttctgcttcttcagcttcacagttcggttcaaataggacaaat
cgtattggaggagctaagcgccgccggcttgtagaggagatagtggagaaacttcttatg
gctgcagttgctgatgctgatgttggtgttagaagttcagtcttcaaggctttgtatcga
aatccagcttttgatgatttcttggcccaagctgacatcttgacttcaatttttgttgcc
ttaaatgatgaggaatatgatgtcagagaattggcaatttctgttgctggtcgattgtct
gaaaagaatcctgcatatgtactgcctgcccttcgtcgctatcttatacaattgctcaca
tatcttgaccagagtatggatagcaagtgtagagaggaaagtgctagattattgggttgt
ttaattaggagctgcgcgcggctcattcttccttacattgctccagttcacaaggcacta
gtgactagattgtgtgaaggaacgggaccaaatgctaataatgctcttgctgcgggagtg
cttgccactgttggagaactggccaaagtgggtggctttgctatgaggcaatatcttcct
gagctgatgcctgtagttgtggattctcttttagatggaggtgctgttagtaaaagggaa
gtggcagtgtcaactctgggacagattatccagagcacaggctatgttattgccccctat
aatgagtaccccccattgcttggcttactcttgaagttgcttaatggtgaattggaatgg
tcaactagactagaagtgctgaaggttttagggattatgggtgcattggaccctcacgca
cacaagcgtaatcagcacaatctacctggtcagcatagagaggtcctacggccaacatcg
aaaccgcacaacatattgtttccatggaagaacctaccgactgactactggccttctttt
cagcatccgaggactactattcaacagttgcaattagctccctcatgcgaattcttcgag
atccttctctttcaagttatcaccaaatggtggttggctcccttatctttatttttaagt
caatgggccttggctgtgttcccatacttaccaaaggttcttcctgatctattccgtgct
gttcgcatgtgcgaggatggtgctttaaaagagttcataacctggaaacttggaacattg
atatctattgtccggcagcacatccgaaaatatttacaagacatactttccctcatctct
gagctgtggacttcctcattcagcttggctgcaccaaatcggaccatacagggcccacag
ggttcaccggttcttcaccttgtcgagcaactatgcttagctttaaatgatgagttcaga
atgtatttacttcacattctaccgagttgtatccaagtcttaggtgacgctgaacgttgc
aatgattattactatgttcctgacatattacacacacttgaagtttttggcggaaatttg
gatgagcacatgcacttggttgctccggtgcttgttcgtttatttaaagtggagctggtt
gatatcaggcggcgtgcaattgttactttgactaatcttatacctaaggttcaggttggt
actcatgtttcggctttagtgcatcatctgaagcttgtcttggatggcaacaacgatgat
ctgcggaaagatgctgcagaagcgctctgctgcctcgcccttggagaagactttactatc
ttcataccatcaatacgcaaaattcttgtgaagcaccacttgcggtacagaaaatgggat
gagattgaaaatcggctactgaggcgagagctactcatcactgaaaacttgtctgtgcaa
aagtacacacaatgtccacctgatgtcattagtgacccccttgatgattgtgatggtaca
ccttctgagatagctgatgaaacacagcgacaagcaagaagtcatcaagtcaatgatgtc
cggttgcggagtgccggtgaggcttctcaaaggagtactagggaagactgggctgaatgg
atgaggcatttcagtattgcgcttctcaaagagtcaccatctccagctttacgcacctgt
gcaaggctagctcagcttcagccttctgttggccgcgagttgtttgctgcaggttttgca
agttgctgggcccaaatgagtgaatcctcccaggaacagctagtgagaagtctcaagaca
gccttctcatctcagaacattcctcctgaaattcttgccacgctgctgaacttagcagaa
tttatggaacatgatgagaagccgcttcctattgatacaagactgcttggtgcacttgct
gagaagtgtcgagcatttgcaaaggcactccattataaagaaatggaatttgaagctgtg
tgcaccaagaagatgggtgcaaatcctgttacagtggttgaatcccttattcatattaac
aatcaactacagcagcatgaggcagctattggcatattgacttactcacagcaaaattcg
gaagttcaattgaaagaatcatggtatgaaaagttgcaccgttgggatgaggctcttaaa
gcatacaccgtgaaatcatctcaaacatctggtcctttacaaaacttggatgctacatta
ggtcgaatgaggtgtctagcagctttggctcggtgggaagatttaagtgcattgtgtaga
gagcaatggacgggtgcagaaccatctgctcgactggaaatggctccaatggctgcaaat
gctgcttggcatatgggtgagtgggaccatatggcagactatgtttctcgcctggatgat
gcagatgaaaataagctccgtatgttgggtaacgcaacagctagtggtgacggaagcagt
aatggtgctttcttccgggcagttcttttagttcgttacaaaaagtatgatgacgctcgg
atgtatgttgagcgagctcggcggtgtttagctacagaacttgcagcactggtacttgag
agttatgagcgagcgtataataacatggtgcgtgttcaacaactttcagaactggaagag
gtgattgattactgcactcttcccatggaaagcccgattgctgacggacggagggaactt
attcgcaatatgtggaatgaacggattaaaggaacaaaacggaatgtcgaggtgtggcaa
gccctacttgctgtcagggagttggttcttccccctaacgaagacagagacacctggata
aagttcgctgaactttgctggaagaacggtcgtattagtcaggctagatctacgttagtc
aaacttttacagtttgatcctgaatcttcccctgaattgacactgtatcatgcacatcca
caagtagctctggcttatctaaaataccagtatgcagttggtgatgagcttaaaaggagg
gatgcattttctaaactgcaagagttgtctgtgcaggttgctaccaccatgggcaattta
cctggaacatcagcaaaccatggcaccatgtcaaatgctggagtaccactcattgctcgt
gtctacttgacacttggtagctggaagaaggcactatcacctgcattagatgacgattcc
attcaagaaattttgatttcttaccataatgccacgctaagtgcaaaggactgggggaag
gcctggcacatatgggctttgttcaacacagaagtcatgtcacgctatactttccgaggc
cgaccagatattgctggaaaatatgttgttgcagcagtaactgggtatttctattctatt
gcttgtgcatctactacgaaaggggtcgatgatagcttgcaggatatccttcgtctgtta
actctttggttcaaccatggggatacctcagaagttcaaacagcgttgcagaaaggtttt
tcccttgtcaagattgagatgtggctggttgtgctgccccagataattgctaggattcat
tcgaacaatagagtagttagagaactgatacaatctttgctagttcgaattggaaagggg
catccacaggctttgatgtatcctctcttggttgcctgcaaatcaataagtatattgaga
caacgtgcagcgcaggaggtcgttgataagatccgccagcacagtggaggtcttgttgac
caggcacaacttgtgtcgaaggaactgatacgggtagcaattttgtggcatgaaatgtgg
catgaggcactcgaggaagctagcaggatgtattttggtgagcacaatatcgaaggaatg
cttgctgtacttgagccattgcatgcaatgcttgagaggggggatgagacaattaaagaa
aatgccttcattcaggcttatgggcatgaattactggaagctcatgaatgctgtttgaaa
tatcgggctacaggagaggatgctgagctaactaaggcctgggatttgtattaccatgtt
ttcagaagaatcgacaaacagcttccaagtcttacgaccctcgatctgcactctgtttcg
cctgagctactcaaatgtcgaaagttggaacttgctgtgccaggaacttatgctgcagat
tcaccacttgtgacgattgagtattttgttccccaattgattgttataacgtccaaacaa
agaccaagaaagctgacaattcatggaagtgatggcaatgattatgcattcttgcttaaa
ggccacgaagatttgcggcaagatgaacgagtaatgcagctttttggtttggtgaatact
ctcctagagaactcaaggaaaacatcagagaaggatttatcaatccaaagatatgctgtt
atacctttgtcacctaacagtggtttaattggatgggttccaaactgtgacacacttcat
gctctgatccgtgaatacagagatgccaggaagattttcttgaatcaggagcacagactt
atgttggcttttgcacccgattatgatcacttacccctcattgcaaaggtggaagtgttt
cagcatgctttgcaaaatactgagggaaatgaccttgcgaaggttctgtggctgaagagt
cgaacttcggaagtatggcttgagcgccgcacaaactacgctagaagcctggctgttatg
agcatggttgggtatttgcttggtttaggagatcggcatccaagcaaccttatgttagat
cgctatagtggaaaaatattacacatcgacttcggagattgctttgaggcttcaatgaat
cgagaaaagttccctgaaaaagtaccattccgtttgactcgaatgcttgtgaaagctatg
gaagttagcggtattgagggtacattccgaacaacttgtgaaaatgtgatgcaagtcctt
cgcacaaacagagacagcgttatggccatgatggaggcatttgtacatgacccgttaatc
aattggcgtctgttcaatttcaatgaggttcctcaagtgtcgaactatggtaatgttcat
gctcacacggttgtcagtagtgaagaagcagtggctaaccgagagctcatgcaacctcag
cgaggagcacgtgagagggaactgctacaggctgtcaatcaactcggtgatgccaatgag
gttttgaatgagcgtgctgtagctgtgatggcacggatgagtgacaaactaacagggcgt
gacttctcttctgggtcagctttggctggagcaggtagctctatccaacatggcagtgag
catttggcttcaggagatgcccgggatgcccaacctggtctctcagtgaaggttcaggtt
cagaagctcatactccaagcgacttcacacgaaaatttgtgccaaaactatgtcgggtgg
tgtccgttctggtga

DBGET integrated database retrieval system