KEGG   Zea mays (maize): 542238Help
Entry
542238            CDS       T01088                                 

Gene name
ae1, SBE1
Definition
amylose extender1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
zma  Zea mays (maize)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    542238 (ae1)
Enzymes [BR:zma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     542238 (ae1)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   542238 (ae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 799 aa AA seqDB search
MAFRVSGAVLGGAVRAPRLTGGGEGSLVFRHTGLFLTRGARVGCSGTHGAMRAAAAARKA
VMVPEGENDGLASRADSAQFQSDELEVPDISEETTCGAGVADAQALNRVRVVPPPSDGQK
IFQIDPMLQGYKYHLEYRYSLYRRIRSDIDEHEGGLEAFSRSYEKFGFNASAEGITYREW
APGAFSAALVGDVNNWDPNADRMSKNEFGVWEIFLPNNADGTSPIPHGSRVKVRMDTPSG
IKDSIPAWIKYSVQAPGEIPYDGIYYDPPEEVKYVFRHAQPKRPKSLRIYETHVGMSSPE
PKINTYVNFRDEVLPRIKKLGYNAVQIMAIQEHSYYGSFGYHVTNFFAPSSRFGTPEDLK
SLIDRAHELGLLVLMDVVHSHASSNTLDGLNGFDGTDTHYFHSGPRGHHWMWDSRLFNYG
NWEVLRFLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVTFTGNFNEYFGFATDVDAV
VYLMLVNDLIHGLYPEAVTIGEDVSGMPTFALPVHDGGVGFDYRMHMAVADKWIDLLKQS
DETWKMGDIVHTLTNRRWLEKCVTYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTP
TIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFPRGPQRLPSGKFIPGNNNSY
DKCRRRFDLGDADYLRYHGMQEFDQAMQHLEQKYEFMTSDHQYISRKHEEDKVIVFEKGD
LVFVFNFHCNNSYFDYRIGCRKPGVYKVVLDSDAGLFGGFSRIHHAAEHFTADCSHDNRP
YSFSVYTPSRTCVVYAPVE
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccgggtttctggggcggtgctcggtggggccgtaagggctccccgactcacc
ggcggcggggagggtagtctagtcttccggcacaccggcctcttcttaactcggggtgct
cgagttggatgttcggggacgcacggggccatgcgcgcggcggccgcggccaggaaggcg
gtcatggttcctgagggcgagaatgatggcctcgcatcaagggctgactcggctcaattc
cagtcggatgaactggaggtaccagacatttctgaagagacaacgtgcggtgctggtgtg
gctgatgctcaagccttgaacagagttcgagtggtccccccaccaagcgatggacaaaaa
atattccagattgaccccatgttgcaaggctataagtaccatcttgagtatcggtacagc
ctctatagaagaatccgttcagacattgatgaacatgaaggaggcttggaagccttctcc
cgtagttatgagaagtttggatttaatgccagcgcggaaggtatcacatatcgagaatgg
gctcctggagcattttctgcagcattggtgggtgacgtcaacaactgggatccaaatgca
gatcgtatgagcaaaaatgagtttggtgtttgggaaatttttctgcctaacaatgcagat
ggtacatcacctattcctcatggatctcgtgtaaaggtgagaatggatactccatcaggg
ataaaggattcaattccagcctggatcaagtactcagtgcaggccccaggagaaatacca
tatgatgggatttattatgatcctcctgaagaggtaaagtatgtgttcaggcatgcgcaa
cctaaacgaccaaaatcattgcggatatatgaaacacatgtcggaatgagtagcccggaa
ccgaagataaacacatatgtaaactttagggatgaagtcctcccaagaataaaaaaactt
ggatacaatgcagtgcaaataatggcaatccaagagcactcatattatggaagctttgga
taccatgtaactaatttttttgcgccaagtagtcgttttggtaccccagaagatttgaag
tctttgattgatagagcacatgagcttggtttgctagttctcatggatgtggttcatagt
catgcgtcaagtaatactctggatgggttgaatggttttgatggtacagatacacattac
tttcacagtggtccacgtggccatcactggatgtgggattctcgcctatttaactatggg
aactgggaagttttaagatttcttctctccaatgctagatggtggctcgaggaatataag
tttgatggtttccgttttgatggtgtgacctccatgatgtacactcaccacggattacaa
gtaacatttacggggaacttcaatgagtattttggctttgccaccgatgtagatgcagtg
gtttacttgatgctggtaaatgatctaattcatggactttatcctgaggctgtaaccatt
ggtgaagatgttagtggaatgcctacatttgcccttcctgttcacgatggtggggtaggt
tttgactatcggatgcatatggctgtggctgacaaatggattgaccttctcaagcaaagt
gatgaaacttggaagatgggtgatattgtgcacacactgacaaataggaggtggttagag
aagtgtgtaacttatgctgaaagtcatgatcaagcattagtcggcgacaagactattgcg
ttttggttgatggacaaggatatgtatgatttcatggccctcgatagaccttcaactcct
accattgatcgtgggatagcattacataagatgattagacttatcacaatgggtttagga
ggagagggctatcttaatttcatgggaaatgagtttggacatcctgaatggatagatttt
ccaagaggtccgcaaagacttccaagtggtaagtttattccagggaataacaacagttat
gacaaatgtcgtcgaagatttgacctgggtgatgcagactatcttaggtatcatggtatg
caagagtttgatcaggcaatgcaacatcttgagcaaaaatatgaattcatgacatctgat
caccagtatatttcccggaaacatgaggaggataaggtgattgtgttcgaaaagggagat
ttggtatttgtgttcaacttccactgcaacaacagctattttgactaccgtattggttgt
cgaaagcctggggtgtataaggtggtcttggactccgacgctggactatttggtggattt
agcaggatccatcacgcagccgagcacttcaccgccgactgttcgcatgataataggcca
tattcattctcggtttatacaccaagcagaacatgtgtcgtctatgctccagtggagtga

DBGET integrated database retrieval system