KEGG   Zea mays (maize): 542252Help
Entry
542252            CDS       T01088                                 

Gene name
mas1, LIP, MS
Definition
malate synthase1 (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
zma  Zea mays (maize)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    542252 (mas1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    542252 (mas1)
   00630 Glyoxylate and dicarboxylate metabolism
    542252 (mas1)
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     542252 (mas1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 559 aa AA seqDB search
MAASTAAPCYDAPEGVDVRGRYDREFAGILTRDALDFVAGLQREFRGAVRYAMEQRREAQ
RRYDAGELPRFDPATTLVREGDWTCASVPPAVADRTVEITGPAEPRKMVINALNSGAKVF
MADFEDAMSPTWENLMHGQVNLRDAVAGTISFRDAPRGRTYELNDRTAKLFVRPRGWHLP
EAHILIDGEPAIGCLVDFGLYFFHNHAAFGAGQGAGFGPLCDLPKMEHSREARIWNGVFQ
RAEKAAGIEPGSIRATVLVETLPAVFQMNEILHELREHSAGLNCGRWDYIFSYVKTFRAH
PDRLLPDRALVGMAQHFMRSYSHLLIHTCHRRGVHAMGGMAAQIPIKDDAAANEAALELV
RKDKLREVRAGHDGTWAAHPGLIPAIREVFEGHLGGRPNQIGDAAGHEGASVKEEDLIQP
PRGARTVDGLRLNVRVGVQYLAAWLAGSGSVPLYNLMEDAATAEISRVQNWQWLRHGAAL
DAGGVEVRATPELLARVVEEEMARVEAEVGPDRFRKGRYAEAGRIFSRQCTAPELDDFLT
LDAYNLIVAHHPGASPCKL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaagcaccgcggcgccatgctacgacgcgccggagggcgtggacgtccgcggg
cggtacgaccgggagttcgcgggcatcctcacccgcgacgcgctggacttcgtggccggc
ctgcagcgcgagttccgcggcgccgtccgctacgccatggagcagcggcgggaggcccag
cgccggtacgacgccggcgagctgccgcggttcgacccggccacgacgctcgtgcgcgag
ggggactggacgtgcgcgtccgtgccgccggccgtcgccgaccgcaccgtggagatcacg
ggccccgccgagccgcggaagatggtcatcaacgcgctcaactccggcgccaaggtcttc
atggctgacttcgaggacgcgatgtcgccgacgtgggagaacctgatgcacgggcaggtg
aacctgcgggacgccgtggctggcaccatcagcttccgcgacgcgccgcgcgggcggacg
tacgagctcaacgaccgaaccgccaagctcttcgtccggccccgcggctggcacctcccc
gaggcgcacatcctcatcgacggcgagccggccatcggctgcctcgtcgacttcggcctc
tacttcttccacaaccacgctgccttcggcgcgggccagggcgccggcttcgggcccttg
tgtgacctgcccaagatggagcactccagagaagcgaggatatggaacggggtgttccag
agagcggagaaagctgctgggatcgagccggggagcatccgggcgacggtgctggtggag
acgttgccggcggtgttccaaatgaacgagatcctgcacgagctgcgcgaacactcggcg
ggactcaactgcggccgctgggactacatcttcagctacgtcaagacgttccgcgcccac
ccggaccgcctcctccccgaccgcgccctcgtcggcatggcccagcacttcatgcgctcc
tactcccacctcctcatccacacctgccaccgtcgcggagtccacgccatgggcggcatg
gcggctcagatcccgatcaaggacgatgcggcggcgaacgaggcggcactggagctggtg
cgcaaggacaagctgagggaggtgcgcgcgggccacgacggcacgtgggcggcgcacccg
gggctcatcccggcgatacgggaggtcttcgagggccacctcggcgggaggccgaaccag
atcggcgacgccgcagggcacgagggcgccagcgtcaaggaggaggacctcatccagccg
ccgcggggcgcgcgcacggtggacggtctgcggctcaacgtccgcgtgggcgtgcagtac
ctcgcggcgtggctggccggctccggctccgtcccgctgtacaacctgatggaggacgcg
gctacggcggagatcagccgcgtccagaactggcagtggctgcgccacggagcggcgctg
gacgccggcggcgtggaggtgcgcgcgacgccagagctactcgcacgcgtcgtcgaggag
gagatggcgagggtcgaggcagaggtcggccccgacaggttccgaaaggggcggtacgcg
gaggcgggcaggatcttcagccggcagtgcactgcgccggagctggacgacttcctcacg
ctggacgcgtacaacctcatcgtggcgcaccatccaggtgcgtcaccgtgcaagctctga

DBGET integrated database retrieval system