KEGG   Zea mays (maize): 542269Help
Entry
542269            CDS       T01088                                 

Gene name
prh1, PP1, ZmPP1
Definition
ser/thr protein phosphatase1 (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
zma  Zea mays (maize)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    542269 (prh1)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     542269 (prh1)
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     542269 (prh1)
Transcription machinery [BR:zma03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     542269 (prh1)
Messenger RNA biogenesis [BR:zma03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     542269 (prh1)
Spliceosome [BR:zma03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    542269 (prh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
4
AA seq 316 aa AA seqDB search
MDPALLDDVIRRLLEVKNLKPGKNAQLSESEIKQLCAAAKEIFLQQPNLLELEAPIKICG
DVHGQYSDLLRLFDYGGYPPQANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRG
NHECASVNRIYGFYDECKRRFSVKLWKTFTDCFNCLPVSALIDEKILCMHGGLSPELNKL
EQILNLNRPTDVPDTGLLCDLLWSDPSNEATGWAINDRGVSFTFGPDKVSEFLEKHDLDL
ICRAHQVVEDGYEFFASRQLVTIFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPARKMM
GGSTNNKSGFKSFRGW
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggatccggcgttgctggacgacgtcatacgccggcttctggaggtgaagaatctcaag
cctgggaagaacgcgcagctgtcagagtcggagattaagcagctctgcgctgccgccaag
gagatcttcctgcagcagcccaacctgctggagctcgaggcccccatcaaaatctgcggt
gatgtccatggccagtactctgatctcctgaggctatttgattatggtggctatccgcct
caggccaactaccttttcttgggtgattatgtggatcgtggaaagcaaagcctagaaaca
atatgtcttcttttggcttacaaggtcaagtacccggagaacttctttcttctaaggggc
aaccatgaatgcgcatcagtaaatcgcatctatggtttttatgacgagtgcaaacgcaga
ttcagtgtaaagctgtggaaaacattcacagactgttttaactgcttgccagtgtcagca
ttgatagatgaaaagattctctgtatgcatggtggtctatctccggagttgaacaagctt
gagcaaatactcaacctgaatcgccccacagacgtgcctgatactggattgctctgtgat
cttctttggtctgatccttccaatgaagcaacaggctgggccatcaatgatcgtggtgtt
tcattcacatttggtcctgataaagtttctgaatttcttgagaagcatgatttggacctt
atctgccgagcacatcaggttgtcgaagatggatacgagtttttcgctagccgtcaactc
gtaacaatattttcagcccctaactactgtggagaattcgacaacgctggtgccatgatg
agtgtagatgatacattgatgtgctcgttccaaatattgaagcctgcaaggaagatgatg
ggtggttcaactaataacaaatctggcttcaagtcattcaggggatggtga

DBGET integrated database retrieval system