KEGG   Zea mays (maize): 542269Help
Entry
542269            CDS       T01088                                 

Gene name
prh1, PP1, ZmPP1
Definition
ser/thr protein phosphatase1 (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
zma  Zea mays (maize)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:zma03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 316 aa AA seqDB search
MDPALLDDVIRRLLEVKNLKPGKNAQLSESEIKQLCAAAKEIFLQQPNLLELEAPIKICG
DVHGQYSDLLRLFDYGGYPPQANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRG
NHECASVNRIYGFYDECKRRFSVKLWKTFTDCFNCLPVSALIDEKILCMHGGLSPELNKL
EQILNLNRPTDVPDTGLLCDLLWSDPSNEATGWAINDRGVSFTFGPDKVSEFLEKHDLDL
ICRAHQVVEDGYEFFASRQLVTIFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPARKMM
GGSTNNKSGFKSFRGW
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggatccggcgttgctggacgacgtcatacgccggcttctggaggtgaagaatctcaag
cctgggaagaacgcgcagctgtcagagtcggagattaagcagctctgcgctgccgccaag
gagatcttcctgcagcagcccaacctgctggagctcgaggcccccatcaaaatctgcggt
gatgtccatggccagtactctgatctcctgaggctatttgattatggtggctatccgcct
caggccaactaccttttcttgggtgattatgtggatcgtggaaagcaaagcctagaaaca
atatgtcttcttttggcttacaaggtcaagtacccggagaacttctttcttctaaggggc
aaccatgaatgcgcatcagtaaatcgcatctatggtttttatgacgagtgcaaacgcaga
ttcagtgtaaagctgtggaaaacattcacagactgttttaactgcttgccagtgtcagca
ttgatagatgaaaagattctctgtatgcatggtggtctatctccggagttgaacaagctt
gagcaaatactcaacctgaatcgccccacagacgtgcctgatactggattgctctgtgat
cttctttggtctgatccttccaatgaagcaacaggctgggccatcaatgatcgtggtgtt
tcattcacatttggtcctgataaagtttctgaatttcttgagaagcatgatttggacctt
atctgccgagcacatcaggttgtcgaagatggatacgagtttttcgctagccgtcaactc
gtaacaatattttcagcccctaactactgtggagaattcgacaacgctggtgccatgatg
agtgtagatgatacattgatgtgctcgttccaaatattgaagcctgcaaggaagatgatg
ggtggttcaactaataacaaatctggcttcaagtcattcaggggatggtga

DBGET integrated database retrieval system