KEGG   Zea mays (maize): 542301Help
Entry
542301            CDS       T01088                                 

Gene name
his2b5
Definition
(RefSeq) histone H2B.5
  KO
K11252  histone H2B
Organism
zma  Zea mays (maize)
Brite
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    542301 (his2b5)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   542301 (his2b5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF RP-C TFIID_20kDa YscO-like Activator-TraM
Motif
Other DBs
NCBI-GeneID: 542301
NCBI-ProteinID: NP_001105358
UniProt: P54348 B4FE18
Position
4
AA seq 154 aa AA seqDB search
MAPKAEKKPAAKKVAEEEPSEKAAPAEKAPAGKKPKAEKRLPAGKSAGKEGGDKKGRKKA
KKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTIT
SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggcggcgaagaaggtggcggaggaggagccctcg
gagaaggcggctccggcggagaaggcccccgcggggaagaagcccaaggcggagaagcgg
ctacctgcgggcaagtccgccggcaaggagggcggggacaagaagggtaggaagaaggcg
aagaagagcgtggagacctacaagatctacatcttcaaggtcctgaagcaggttcacccc
gacatcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttc
gagaagctcgccgcggaggccgccaagctcgcccggtacaacaagaagcccaccatcacc
tcccgcgagatccagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgcc
gtctcggagggtaccaaggccgtcaccaagttcacctcgtcttag

DBGET integrated database retrieval system