KEGG   Zea mays (maize): 542319Help
Entry
542319            CDS       T01088                                 

Gene name
ACC1
Definition
acetyl-coenzyme A carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
zma  Zea mays (maize)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    542319 (ACC1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    542319 (ACC1)
   00640 Propanoate metabolism
    542319 (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    542319 (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    542319 (ACC1)
Enzymes [BR:zma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     542319 (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     542319 (ACC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 2325 aa AA seqDB search
MSQLGLAAAASKALPLLPNRQRSSAGTTFSSSSLSRPLNRRKSHTRSLRDGGDGVSDAKK
HSQSVRQGLAGIIDLPSEAPSEVDISHGSEDPRGPTDSYQMNGIINETHNGRHASVSKVV
EFCAALGGKTPIHSILVANNGMAAAKFMRSVRTWANDTFGSEKAIQLIAMATPEDMRINA
EHIRIADQFVEVPGGTNNNNYANVQLIVGMAQKLGVSAVWPGWGHASENPELPDALTAKG
IVFLGPPASSMNALGDKVGSALIAQAAGVPTLAWSGSHVEVPLECCLDAIPEEMYRKACV
TTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVHNDDEVRALFKQVQGEVPGSPIFVMRL
ASQSRHLEVQLLCDQYGNVAALHSRDCSVQRRHQKIIEEGPVTVAPRETVKALEQAARRL
AKAVGYVGAATVEYLYSMETGDYYFLELNPRLQVEHPVTEWIAEVNLPAAQVAVGMGIPL
WQIPEIRRFYGMDYGGGYDIWRKTAALATPFNFDEVDSQWPKGHCVAVRITSEDPDDGFK
PTGGKVKEISFKSKPNVWAYFSVKSGGGIHEFADSQFGHAFAYGLSRPAAITNMSLALKE
IQIRGEIHSNVDYTVDLLNASDFRENKIHTGWLDTRIAMRVQAERPPWYISVVGGALYKT
VTTNAATVSEYVSYLTKGHIPPKHISLVNSTVNLNIEGSKYTIETVRTGHGSYRLRMNDS
TVEANVQSLCDGGLLMQLDGNSHVIYAEEEAGGTRLQIDGKTCLLQNDHDPSKLLAETPC
KLLRFLVADGAHVDADVPYAEVEVMKMCMPLLSPASGVIHCMMSEGQALQAGDLIARLDL
DDPSAVKRAEPFDGIFPQMELPVAVSSQVHKRYAASLNAARMVLAGYEHNINEVVQDLVC
CLDNPELPFLQWDELMSVLATRLPRNLKSELEDKYKEYKLNFYHGKNEDFPSKLLRDIIE
ENLSYGSEKEKATNERLVEPLMNLLKSYEGGRESHAHFVVKSLFEEYLTVEELFSDGIQS
DVIETLRHQHSKDLQKVVDIVLSHQGVRNKAKLVTALMEKLVYPNPGGYRDLLVRFSSLN
HKRYYKLALKASELLEQTKLSELRASVARSLSDLGMHKGEMSIKDNMEDLVSAPLPVEDA
LISLFDYSDRTVQQKVIETYISRLYQPHLVKDSIQMKFKESGAITFWEFYEGHVDTRNGH
GAIIGGKRWGAMVVLKSLESASTAIVAALKDSAQFNSSEGNMMHIALLSAENESNISGIS
SDDQAQHKMEKLSKILKDTSVASDLQAAGLKVISCIVQRDEARMPMRHTFLWLDDKSCYE
EEQILRHVEPPLSTLLELDKLKVKGYNEMKYTPSRDRQWHIYTLRNTENPKMLHRVFFRT
IVRQPNAGNKFRSAQISDAEVGCPEESLSFTSNSILRSLMTAIEELELHAIRTGHSHMYL
CILKEQKLLDLIPFSGSTIVDVGQDEATACSLLKSMALKIHELVGARMHHLSVCQWEVKL
KLDCDGPASGTWRVVTTNVTGHTCTIDIYREVEEIESQKLVYHSASSSAGPLHGVALNNP
YQPLSVIDLKRCSARNNRTTYCYDFPLAFETALQKSWQSNGSTVSEGNENSKSYVKATEL
VFAEKHGSWGTPIIPMERPAGLNDIGMVAWIMEMSTPEFPNGRQIIVVANDITFRAGSFG
PREDAFFETVTNLACERKLPLIYLAANSGARIGIADEVKSCFRVGWSDEGSPERGFQYIY
LTEEDYARISSSVIAHKLELDSGEIRWIIDSVVGKEDGLGVENIHGSAAIASAYSRAYEE
TFTLTFVTGRTVGIGAYLARLGIRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPK
IMATNGVVHLTVPDVLEGVSNILRWLSYVPANIGGPLPITKPLDPPDRPVAYIPENTCDP
RAAICGVDDSQGKWLGGMFDKDSFVETFEGWAKTVVTGRAKLGGIPVGVIAVETQTMMQI
IPADPGQLDSHERSVPRAGQVWFPDSATKTAQALLDFNREGLPLFILANWRGFSGGQRDL
FEGILQAGSTIVENLRTYNQPAFVYIPMAGELRGGAWVVVDSKINPDRIECYAERTAKGN
VLEPQGLIEIKFRSEELQDCMGRLDPELINLKAKLQDVNHGNGSLPDIEGIRKSIEARTK
QLLPLYTQIAIRFAELHDTSLRMAAKGVIKKVVDWEESRSFFYKRLRRRIAEDVLAKEIR
QIVGDKFTHQLAMELIKEWYLASQATTGSTGWDDDDAFVAWKDSPENYKGHIQKLRAQKV
SHSLSDLADSSSDLQAFSQGLSTLLDKMDPSQRAKFVQEVKKVLD
NT seq 6978 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagcttggattagccgcagctgcctcaaaggccttgccactactccctaatcgc
cagagaagttcagctgggactacattctcatcatcttcattatcgaggcccttaaacaga
aggaaaagccatactcgttcactccgtgatggcggagatggggtatcagatgccaaaaag
cacagccagtctgttcgtcaaggtcttgctggcattatcgacctcccaagtgaggcacct
tccgaagtggatatttcacatggatctgaggatcctagggggccaacagattcttatcaa
atgaatgggattatcaatgaaacacataatggaagacatgcctcagtgtccaaggttgtt
gaattttgtgcggcactaggtggcaaaacaccaattcacagtatattagtggccaacaat
ggaatggcagcagcaaaatttatgaggagtgtccggacatgggctaatgatacttttgga
tctgagaaggcaattcaactcatagctatggcaactccggaagacatgaggataaatgca
gaacacattagaattgctgaccaattcgtagaggtgcctggtggaacaaacaataataac
tacgccaatgttcaactcatagtggggatggcacaaaaactaggtgtttctgctgtttgg
cctggttggggtcatgcttctgagaatcctgaactgccagatgcattgaccgcaaaaggg
atcgtttttcttggcccacctgcatcatcaatgaatgctttgggagataaggtcggctca
gctctcattgctcaagcagccggggtcccaactcttgcttggagtggatcacatgttgaa
gttccattagagtgctgcttagacgcgatacctgaggagatgtatagaaaagcttgcgtt
actaccacagaggaagcagttgcaagttgtcaagtggttggttatcctgccatgattaag
gcatcctggggaggtggtggtaaaggaataagaaaggttcataatgatgatgaggttaga
gcgctgtttaagcaagtacaaggtgaagtccctggctccccaatatttgtcatgaggctt
gcatcccagagtcggcatcttgaagttcagttgctttgtgatcaatatggtaatgtagca
gcacttcacagtcgtgattgcagtgtgcaacggcgacaccagaagattattgaagaaggt
ccagttactgttgctcctcgtgagacagttaaagcacttgagcaggcagcaaggaggctt
gctaaggctgtgggttatgttggtgctgctactgttgagtatctttacagcatggaaact
ggagactactattttctggaacttaatccccgactacaggttgagcatccagtcactgag
tggatagctgaagtgaatctgcctgcagctcaagttgctgttggaatgggcatacctctt
tggcagattccagaaatcagacgtttctatggaatggactatggaggagggtatgacatt
tggaggaaaacagcagctcttgctacaccatttaattttgatgaagtagattctcaatgg
ccaaagggccattgtgtagcagttagaattactagtgaggacccagatgatggtttcaaa
cctactggtgggaaagtgaaggagataagttttaaaagcaagcctaatgtttgggcctac
ttctcagtaaagtctggtggaggcattcatgaatttgctgattctcagtttggacatgct
tttgcatatggactctctagaccagcagctataacaaacatgtctcttgcattaaaagag
attcagattcgtggagaaattcattcaaatgttgattacacagttgacctcttaaacgct
tcagacttcagagaaaacaagatccacactggttggctggatacaagaatagctatgcgt
gttcaagctgagaggcccccatggtatatctcagtggttggaggtgctttatataaaaca
gtaaccaccaatgcagccactgtttctgaatatgttagttatctcaccaagggccatatt
ccaccaaagcatatatcccttgtcaattctacagttaatttgaatatagaagggagcaaa
tacacaattgaaactgtaaggactggacatggtagctacaggttgagaatgaatgattca
acagttgaagcgaatgtacaatctttatgtgatggtggcctcttaatgcagttggatgga
aacagccatgtaatttatgcagaagaagaagctggtggtacacggcttcagattgatgga
aagacatgtttattgcagaatgaccatgatccatcgaagttattagctgagacaccctgc
aaacttcttcgtttcttggttgctgatggtgctcatgttgatgcggatgtaccatacgcg
gaagttgaggttatgaagatgtgcatgcctctcttgtcacctgcttctggtgtcattcat
tgtatgatgtctgagggccaggcattgcaggctggtgatcttatagcaaggttggatctt
gatgacccttctgctgtgaaaagagctgagccatttgatggaatatttccacaaatggag
ctccctgttgctgtctctagtcaagtacacaaaagatatgctgcaagtttgaatgctgct
cgaatggtccttgcaggatatgagcacaatattaatgaagtcgttcaagatttggtatgc
tgcctggacaaccctgagcttcctttcctacagtgggatgaacttatgtctgttctagca
acgaggcttccaagaaatctcaagagtgagttagaggataaatacaaggaatacaagttg
aatttttaccatggaaaaaacgaggactttccatccaagttgctaagagacatcattgag
gaaaatctttcttatggttcagagaaggaaaaggctacaaatgagaggcttgttgagcct
cttatgaacctactgaagtcatatgagggtgggagagagagccatgcacattttgttgtc
aagtctcttttcgaggagtatcttacagtggaagaactttttagtgatggcattcagtct
gacgtgattgaaacattgcggcatcagcacagtaaagacctgcagaaggttgtagacatt
gtgttgtctcaccagggtgtgaggaacaaagctaagcttgtaacggcacttatggaaaag
ctggtttatccaaatcctggtggttacagggatctgttagttcgcttttcttccctcaat
cataaaagatattataagttggcccttaaagcaagtgaacttcttgaacaaaccaaacta
agtgaactccgtgcaagcgttgcaagaagcctttcggatctggggatgcataagggagaa
atgagtattaaggataacatggaagatttagtctctgccccattacctgttgaagatgct
ctgatttctttgtttgattacagtgatcgaactgttcagcagaaagtgattgagacatac
atatcacgattgtaccagcctcatcttgtaaaggatagcatccaaatgaaattcaaggaa
tctggtgctattactttttgggaattttatgaagggcatgttgatactagaaatggacat
ggggctattattggtgggaagcgatggggtgccatggtcgttctcaaatcacttgaatct
gcgtcaacagccattgtggctgcattaaaggattcggcacagttcaacagctctgagggc
aacatgatgcacattgcattattgagtgctgaaaatgaaagtaatataagtggaataagc
agtgatgatcaagctcaacataagatggaaaagcttagcaagatactgaaggatactagc
gttgcaagtgatctccaagctgctggtttgaaggttataagttgcattgttcaaagagat
gaagctcgcatgccaatgcgccacacattcctctggttggatgacaagagttgttatgaa
gaagagcagattctccggcatgtggagcctcccctctctacacttcttgaattggataag
ttgaaggtgaaaggatacaatgaaatgaagtatactccttcgcgtgaccgccaatggcat
atctacacactaagaaatactgaaaaccccaaaatgttgcatagggtgtttttccgaact
attgtcaggcaacccaatgcaggcaacaagtttagatcggctcagatcagcgacgctgag
gtaggatgtcccgaagaatctctttcatttacatcaaatagcatcttaagatcattgatg
actgctattgaagaattagagcttcatgcaattaggacaggtcattctcacatgtatttg
tgcatactgaaagagcaaaagcttcttgacctcattccattttcagggagtacaattgtt
gatgttggccaagatgaagctaccgcttgttcacttttaaaatcaatggctttgaagata
catgagcttgttggtgcaaggatgcatcatctgtctgtatgccagtgggaggtgaaactc
aagttggactgtgatggccctgcaagtggtacctggagagttgtaactacaaatgttact
ggtcacacctgcaccattgatatataccgagaagtggaggaaatagaatcacagaagtta
gtgtaccattcagccagttcgtcagctggaccattgcatggtgttgcactgaataatcca
tatcaacctttgagtgtgattgatctaaagcgctgctctgctaggaacaacagaacaaca
tattgctatgattttccgctggcctttgaaactgcactgcagaagtcatggcagtccaat
ggctctactgtttctgaaggcaatgaaaatagtaaatcctacgtgaaggcaactgagcta
gtgtttgctgaaaaacatgggtcctggggcactcctataattccgatggaacgccctgct
gggctcaacgacattggtatggtcgcttggatcatggagatgtcaacacctgaatttccc
aatggcaggcagattattgttgtagcaaatgatatcactttcagagctggatcatttggc
ccaagggaagatgcattttttgaaactgtcactaacctggcttgcgaaaggaaacttcct
cttatatacttggcagcaaactctggtgctaggattggcatagctgatgaagtaaaatct
tgcttccgtgttggatggtctgacgaaggcagtcctgaacgagggtttcagtacatctat
ctgactgaagaagactatgctcgcattagctcttctgttatagcacataagctggagcta
gatagtggtgaaattaggtggattattgactctgttgtgggcaaggaggatgggcttggt
gtcgagaacatacatggaagtgctgctattgccagtgcttattctagggcatatgaggag
acatttacacttacatttgtgactgggcggactgtaggaataggagcttatcttgctcga
cttggtatacggtgcatacagcgtcttgaccagcctattattttaacagggttttctgcc
ctgaacaagctccttgggcgggaagtgtacagctcccacatgcagcttggtggtcctaag
atcatggcgaccaatggtgttgtccacctcactgttccagatgtccttgaaggtgtttcc
aatatattgaggtggctcagctatgttcctgcaaacattggtggacctcttcctattacc
aaacctctggaccctccagacagacctgttgcttacatccctgagaacacatgcgatcca
cgtgcagctatctgtggtgtagatgacagccaagggaaatggttgggtggtatgtttgac
aaagacagctttgtggagacatttgaaggatgggcaaaaacagtggttactggcagagca
aagcttggaggaattcctgtgggcgtcatagctgtggagacacagaccatgatgcagatc
atccctgctgatccaggtcagcttgattcccatgagcgatctgtccctcgtgctggacaa
gtgtggttcccagattctgcaaccaagaccgctcaggcattattagacttcaaccgtgaa
ggattgcctctgttcatcctggctaattggagaggcttctctggtggacaaagagatctc
tttgaaggaattcttcaggctgggtcaacaattgtcgagaaccttaggacatataatcag
cctgcttttgtgtacattcctatggctggagagcttcgtggaggagcttgggttgtggtc
gatagcaaaataaatccagaccgcattgagtgttatgctgaaaggactgccaaaggtaat
gttctcgaacctcaagggttaattgaaatcaagttcaggtcagaggaactccaagactgt
atgggtaggcttgacccagagttgataaatctgaaagcaaaactccaagatgtaaatcat
ggaaatggaagtctaccagacatagaagggattcggaagagtatagaagcacgtacgaaa
cagttgctgcctttatatacccagattgcaatacggtttgctgaattgcatgatacttcc
ctaagaatggcagctaaaggtgtgattaagaaagttgtagactgggaagaatcacgctcg
ttcttctataaaaggctacggaggaggatcgcagaagatgttcttgcaaaagaaataagg
cagatagtcggtgataaatttacgcaccaattagcaatggagctcatcaaggaatggtac
cttgcttctcaggccacaacaggaagcactggatgggatgacgatgatgcttttgttgcc
tggaaggacagtcctgaaaactacaaggggcatatccaaaagcttagggctcaaaaagtg
tctcattcgctctctgatcttgctgactccagttcagatctgcaagcattctcgcagggt
ctttctacgctattagataagatggatccctctcagagagcgaagtttgttcaggaagtc
aagaaggtccttgattga

DBGET integrated database retrieval system