KEGG   Zea mays (maize): 542356Help
Entry
542356            CDS       T01088                                 

Gene name
mek1
Definition
MEK homolog1
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
zma  Zea mays (maize)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:zma00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    542356 (mek1)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     542356 (mek1)
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   542356 (mek1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 355 aa AA seqDB search
MKGKKPVKELKLTVPAQETPVDKFLTASGTFKDGELRLNQSGLRLISEENGDEDESTKLK
VEDVQLSMDDLEMIQVIGKGSGGVVQLVRHKWVGTLFALKGIQMNIQESVRKQIVQELKI
NQATQSPHIVMCHQSFYHNGVIYLVLEYMDRGSLADIVKQVKTILEPYLAVLCKQVLEGL
LYLHHQRHVIHRDIKPSNLLVNRKGEVKITDFGVSAVLASSIGQRDTFVGTYNYMAPERI
SGSTYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYELLEAIVDQPPPSAPADQFS
PEFCSFISSCIQKDPAQRMSASELLNHPFLKKFEDKDLNLGILVENLEPPMNIPE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaagaagccggtcaaggagctcaagctcaccgtgccggcgcaggagaccccg
gtagacaagttcctgacggcaagtggcacgttcaaggatggtgagctgaggctcaatcag
agcggcttgcggcttatctctgaggaaaacggggatgaagatgaatctacaaagctgaag
gtggaagatgtgcagttatcaatggatgatcttgagatgattcaagtcattggcaaagga
agcggtggtgttgtccagctagtgaggcacaaatgggtgggcacattatttgccttaaag
ggtattcaaatgaacattcaggagtcagttcgtaaacagatagtacaggagctcaaaata
aaccaagcaacacagagccctcatatagttatgtgccatcaatctttttaccacaatggt
gtaatatatcttgttcttgagtacatggaccgtggatcgcttgcagacattgttaagcaa
gtgaagactattctggagccataccttgcagtactttgtaagcaggtcttggagggttta
ttgtatcttcatcatcaaaggcacgtgattcacagggacataaaaccatctaacttgttg
gtcaaccgtaaaggtgaagtcaagattaccgacttcggagtgagtgctgtgctagcaagc
tcaataggtcagcgagatacatttgttggaacctacaactatatggcgcctgagcggatt
agtggtagcacttatgactacaaaagtgacatatggagtttgggcttagttatacttgag
tgtgccattggccggttcccttatataccttcggaaggtgaaggttggttaagcttttat
gaacttctggaggccattgtcgatcagccaccaccttctgcacctgcagatcagttctct
ccagaattctgctcatttatctcctcttgcatacagaaagatccggctcagaggatgtct
gcttcagaactcttgaatcacccttttttgaagaagttcgaggataaggacttaaacctg
gggattcttgtggagaacctggaacctccaatgaatatacccgaatag

DBGET integrated database retrieval system