KEGG   Zea mays (maize): 542363Help
Entry
542363            CDS       T01088                                 

Gene name
adh1, Adh1-1F, Adh1-1S
Definition
alcohol dehydrogenase1 (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    542363 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    542363 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    542363 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    542363 (adh1)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     542363 (adh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MATAGKVIKCKAAVAWEAGKPLSIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT
PVFPRIFGHEAGGIIESVGEGVTDVAPGDHVLPVFTGECKECAHCKSAESNMCDLLRINT
DRGVMIADGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCVAKINPQAPLDKVCVLSCGYS
TGLGASINVAKPPKGSTVAVFGLGAVGLAAAEGARIAGASRIIGVDLNPSRFEEARKFGC
TEFVNPKDHNKPVQEVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHK
DAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFAEINK
AFDLMAKGEGIRCIIRMEN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcggggaaggtgatcaagtgcaaagctgcggtggcatgggaggccggcaag
ccactgtcgatcgaggaggtggaggtagcgcctccgcaggccatggaggtgcgcgtcaag
atcctcttcacctcgctctgccacaccgacgtctacttctgggaggccaaggggcagact
cccgtgttccctcggatctttggccacgaggctggaggtatcatagagagtgttggagag
ggtgtgactgacgtagctccgggcgaccatgtccttcctgtgttcactggggagtgcaag
gagtgtgcccactgcaagtcggcagagagcaacatgtgtgatctgctcaggatcaacacc
gaccgcggtgtgatgattgccgatggcaagtcgcggttttcaatcaatgggaagcctatc
taccactttgttgggacttccaccttcagcgagtacaccgtcatgcatgtgggttgtgtt
gcaaagatcaaccctcaggctccccttgataaagtttgcgtccttagctgtggttattct
accggtcttggtgcatcaattaatgttgcaaaacctccgaagggttcgacagtggctgtt
ttcggtttaggagccgttggtcttgccgctgcagaaggtgcaaggattgctggagcgtca
aggatcattggtgtcgacctgaaccccagcagattcgaagaagctaggaagttcggttgc
actgaatttgtgaacccaaaagaccacaacaagccagtgcaggaggtacttgctgagatg
accaacggaggggtcgaccgcagtgtggaatgcactggcaacattaatgctatgatccaa
gctttcgaatgtgttcatgatggctggggtgttgctgtgctggtgggtgtgccacataag
gacgctgagttcaagacccacccgatgaacttcctgaacgaaaggaccctgaaggggacc
ttctttggcaactataagccacgcactgatctgccaaatgtggtggagctgtacatgaaa
aaggagctggaggtggagaagttcatcacgcacagcgtcccgttcgccgagatcaacaag
gcgttcgacctgatggccaagggggagggcatccgctgcatcatccgcatggagaactag

DBGET integrated database retrieval system