KEGG   Zea mays (maize): 542409Help
Entry
542409            CDS       T01088                                 

Gene name
prf1
Definition
(RefSeq) profilin-1
  KO
K05759  profilin
Organism
zma  Zea mays (maize)
Brite
Membrane trafficking [BR:zma04131]
 Others
  Actin-binding proteins
   Others
    542409 (prf1)
Cytoskeleton proteins [BR:zma04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     542409 (prf1)
Exosome [BR:zma04147]
 Exosomal proteins
  Proteins found in most exosomes
   542409 (prf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 542409
NCBI-ProteinID: NP_001105450
UniProt: P35081 C0PNL3
Position
6
AA seq 131 aa AA seqDB search
MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKAEEMAAIMKDFDEPGHL
APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE
RLGDYLLEQGM
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacgtacgtggacgagcacctgatgtgcgagatcgagggccaccacctc
acgtcggcggccatcgtcggccacgacggcgccacctgggcgcagagcaccgcattcccc
gagttcaaggccgaggagatggctgccatcatgaaggatttcgacgagccggggcacctc
gccccgaccggcctgatactgggaggcaccaagtacatggtcatccaaggcgaacctgga
gctgtcatccgtggcaagaagggatccgggggcatcactgtgaagaaaacagggcagtca
ctcatcattggcatctacgacgagcccatgactcccgggcagtgcaacctggtggtggaa
aggctgggcgactacctgctcgaacaggggatgtaa

DBGET integrated database retrieval system