KEGG   Zea mays (maize): 542410Help
Entry
542410            CDS       T01088                                 

Gene name
prf2, GRMZM2G109842, PRO2, Profilin-2
Definition
(RefSeq) profilin homolog 2
  KO
K05759  
profilin
Organism
zma  Zea mays (maize)
Brite
Membrane trafficking [BR:zma04131]
 Others
  Actin-binding proteins
   Others
    542410 (prf2)
Cytoskeleton proteins [BR:zma04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     542410 (prf2)
Exosome [BR:zma04147]
 Exosomal proteins
  Proteins found in most exosomes
   542410 (prf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 137 aa AA seqDB search
MSDRAKMSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDF
DEPGHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQ
CNMVVERLGDYLLEQGM
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccgggcaaagatgtcgtggcaggcgtacgtggacgagcacctgatgtgcgag
atcgagggccaccacctcgcggcggcggccatcgtcggccacgacggtgccgcctgggcg
cagagcacggcgttccccgagttcaagaccgaggacatggccaacatcatgaaggacttc
gacgagccggggcacctcgcgccgacaggcctgttcctcggtcctaccaagtacatggtc
atccaaggcgagcctggtgccgtcatccgtggcaagaagggatcaggaggcatcaccgtg
aagaagacagggcaggcactcgtggttggcatctacgacgagccgatgacgcctgggcag
tgcaacatggtggtggaaaggctgggcgactacctgcttgaacagggcatgtaa

DBGET integrated database retrieval system