KEGG   Zea mays (maize): 542410Help
Entry
542410            CDS       T01088                                 

Gene name
prf2, PRO2, Profilin-2
Definition
profilin homolog2
Orthology
K05759  
profilin
Organism
zma  Zea mays (maize)
Brite
Exosome [BR:zma04147]
 Exosomal proteins
  Proteins found in most exosomes
   542410 (prf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 137 aa AA seqDB search
MSDRAKMSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDF
DEPGHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQ
CNMVVERLGDYLLEQGM
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccgggcaaagatgtcgtggcaggcgtacgtggacgagcacctgatgtgcgag
atcgagggccaccacctcgcggcggcggccatcgtcggccacgacggtgccgcctgggcg
cagagcacggcgttccccgagttcaagaccgaggacatggccaacatcatgaaggacttc
gacgagccggggcacctcgcgccgacaggcctgttcctcggtcctaccaagtacatggtc
atccaaggcgagcctggtgccgtcatccgtggcaagaagggatcaggaggcatcaccgtg
aagaagacagggcaggcactcgtggttggcatctacgacgagccgatgacgcctgggcag
tgcaacatggtggtggaaaggctgggcgactacctgcttgaacagggcatgtaa

DBGET integrated database retrieval system