KEGG   Zea mays (maize): 542411Help
Entry
542411            CDS       T01088                                 

Gene name
prf3, PRO3
Definition
Profilin homolog3
Orthology
K05759  
profilin
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 131 aa AA seqDB search
MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL
APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacgtacgtcgatgagcacctcatgtgcgagatcgagggccaccacctg
agctctgccgccatagtcggccacgacggcgccgtttgggcccagagcaccgcattccca
cagttcaagccagaggagatgaccaacatcattaaggacttcgacgagcctgggtttctg
gccccgatcggcctcttccttggccccaccaagtacatggtcatccaaggcgagcccggc
gctgtcatccgcgggaagaagggatctggaggcataactgtgaagaagaccggacaggcg
ctggtgatcggcatctacgacgagcccatgacccctggacagtgcaacatggtggttgag
aggctcggtgactacctcgtagagcaaggcctgtga

DBGET integrated database retrieval system