KEGG   Zea mays (maize): 542435Help
Entry
542435            CDS       T01088                                 

Gene name
asn1, AS, AsnS1
Definition
asparagine synthetase homolog1 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
zma  Zea mays (maize)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    542435 (asn1)
Enzymes [BR:zma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     542435 (asn1)
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C44
   542435 (asn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 591 aa AA seqDB search
MCGILAVLGVAEVSLAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHQRLAIIDPTSGD
QPLYNEDKTVVVTVNGEIYNHEELKAKLKTHEFQTGSDCEVIAHLYEEYGEEFVDMLDGM
FSFVLLDTRDKSFIAARDAIGICPLYMGWGLDGSVWFSSEMKALSDDCERFITFPPGHLY
SSKTGGLRRWYNPPWFSETVPSTPYNALFLREMFEKAVIKRLMTDVPFGVLLSGGLDSSL
VASVASRHLNETKVDRQWGNKLHTFCIGLKGSPDLKAAREVADYLSTVHHEFHFTVQEGI
DALEEVIYHIETYDVTTIRASTPMFLMSRKIKSLGVKMVISGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHLYDCLRANKATSAWGVEARVPFLDKSFISVAMDIDPEWKMIKRD
LGRIEKWVIRNAFDDDERPYLPKHILYRQKEQFSDGVGYSWIDGLKDHASQHVSDSMMMN
AGFVYPENTPTTKEGYYYRMIFEKFFPKPAARSTVPGGPSVACSTAKAVEWDASWSKNLD
PSGRAALGVHDAAYEDTAGKTPASADPVSDKGLRPAIGESLGTPVASATAV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcctcgctgtcctcggcgtcgctgaggtctccctcgccaagcgctcccgc
atcattgagctctcgcgcaggttacggcaccgagggcctgattggagtggtttgcactgt
catgaggattgttaccttgcacaccagcggttggctattatcgatcctacatctggagac
cagcctttgtacaatgaggataaaacagttgttgtaacggtgaacggagagatctataac
catgaagaattgaaagctaagttgaaaactcatgagttccaaactggcagtgattgtgaa
gttatagcccatctttacgaagaatatggcgaagaatttgtggatatgttggatggaatg
ttctcctttgttcttcttgatacacgtgataaaagcttcatcgcagctcgtgatgctatt
ggcatctgccctttatacatgggatggggtcttgatggatcagtctggttttcttcagag
atgaaggcattgagtgatgattgtgaacgcttcataacatttcccccagggcatctctac
tccagcaagacaggtggtctaaggagatggtacaacccaccatggttttcagagacggtc
ccttcaaccccttacaatgctctcttcctccgggagatgtttgagaaggctgttattaag
aggctgatgactgatgtgccatttggtgtgcttttatctggtggactcgactcttctttg
gttgcatctgttgcttcgcggcacttaaacgaaacaaaggttgacaggcagtggggaaat
aaattgcatactttctgtataggcttgaagggttctcctgatcttaaagctgctagagaa
gttgctgattacctcagcactgtacatcatgagttccacttcacagtgcaggagggcatt
gatgccttggaagaagtcatctaccatattgagacatatgatgttacaacaatcagagca
agtaccccaatgtttttgatgtcacgcaaaatcaaatctttgggtgtgaagatggttatt
tctggcgaaggttcagatgaaatttttggtggttacctttattttcacaaggcaccaaac
aagaaagaattccatgaggaaacatgtcggaagataaaagcactacatctgtatgactgc
ttgagagctaacaaagcaacttctgcctggggtgttgaggctcgtgttccattccttgac
aaaagtttcatcagtgtagcaatggacattgatcctgaatggaagatgataaaacgtgac
ctcggtcgaattgagaaatgggttatccgtaatgcatttgatgatgatgagaggccctat
ttacctaagcacattctctacaggcaaaaggaacagttcagtgatggtgttgggtatagt
tggatcgatggattgaaggaccatgccagccaacatgtctccgattccatgatgatgaat
gctggctttgtttacccagagaacacacccacaacaaaagaagggtactactacagaatg
atattcgagaaattctttcccaagcctgcagcaaggtcaactgttcctggaggtcctagt
gtggcctgcagcactgccaaagctgttgaatgggacgcatcctggtccaagaaccttgat
ccttctggccgtgctgctttgggtgttcacgatgctgcgtatgaagacactgcagggaaa
actcctgcctctgctgatcctgtctcagacaagggccttcgtccagctattggcgaaagc
ctagggacacccgttgcttcagccacagctgtctaa

DBGET integrated database retrieval system