KEGG   Zea mays (maize): 542435Help
Entry
542435            CDS       T01088                                 

Gene name
asn1, AS, AsnS1
Definition
asparagine synthetase homolog1 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
zma  Zea mays (maize)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:zma00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 586 aa AA seqDB search
MCGILAVLGVVEVSLAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHQRLAIIDPTSGD
QPLYNEDKTVVVTVNGEIYNHEELKAKLKTHEFQTGSDCEVIAHLYEEYGEEFVDMLDGM
FSFVLLDTRDKSFIAARDAIGICPLYMGWGLDGSVWFSSEMKALSDDCERFITFPPGHLY
SSKTGGLRRWYNPPWFSETVPSTPYNALFLREMFEKAVIKRLMTDVPFGVLLSGGLDSSL
VASVASRHLNETKVDRQWGNKLHTFCIGLKGSPDLKAAREVADYLSTVHHEFHFTVQEGI
DALEEVIYHIETYDVTTIRASTPMFLMSRKIKSLGVKMVISGEGSDEIFGGYLYFHKAPN
KKEFLEETCRKIKALHLYDCLRANKATSAWGVEARVPFLDKSFISVAMDIDPEWNMIKRD
LGRIEKWVMRKAFDDDEHPYLPKHILYRQKEQFSDGVGYNWIDGLKSFTEQQVTDEMMNN
AAQMFPYNTPVNKEAYYYRMIFERLFPQDSARETVPWGPSIACSTPAAIEWVEQWKASND
PSGRFISSHDSAATDHTAVSRRWPTAAARPANGTVNGKDVPVPIAV
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattctggcggtgctgggcgtcgttgaggtctccctcgccaagcgctcccgc
atcattgagctctcgcgcaggttacggcaccgagggcctgattggagtggtttgcactgt
catgaggattgttaccttgcacaccagcggttggctattatcgatcctacatctggagac
cagcctttgtacaatgaggataaaacagttgttgtaacggtgaacggcgaaatttacaat
catgaagaattgaaagctaagttgaaaactcatgagttccaaactggcagtgattgtgaa
gttatagcccatctttacgaagaatatggcgaagaatttgtggatatgttggatggaatg
ttctcctttgttcttcttgatacacgtgataaaagcttcatcgcagctcgtgatgctatt
ggcatctgccctttatacatgggatggggtcttgatggatcagtctggttttcttcagag
atgaaggcattgagtgatgattgtgaacgcttcataacatttcccccagggcatctctac
tccagcaagacaggtggtctaaggagatggtacaacccaccatggttttcagagactgtc
ccttcaaccccttacaatgctctcttcctccgggagatgtttgagaaggctgttattaag
aggctgatgactgatgtgccatttggtgtgcttttatctggtggactcgactcttctttg
gttgcatctgttgcttcgcggcacttaaacgaaacaaaggttgacaggcagtggggaaat
aaattgcatactttctgtataggcttgaagggttctcctgatcttaaagctgctagagaa
gttgctgattacctcagcactgtacatcatgagttccacttcacagtgcaggaggggatt
gatgccttggaagaagtcatctaccatattgagacatatgatgttacaacaatcagagca
agtaccccaatgtttttgatgtcacgcaaaatcaaatctttgggtgtgaagatggttatt
tctggcgaaggttcagatgaaatttttggtggttacctttattttcacaaggcaccaaac
aagaaagaattcctagaggaaacatgtcggaagataaaagcactacatctgtatgactgc
ttgagagctaacaaagcaacttctgcctggggtgttgaggctcgtgttccattccttgac
aaaagtttcatcagtgtagcaatggacattgatcctgaatggaacatgataaaacgtgac
ctcggtcgaattgagaagtgggtcatgaggaaggcgttcgacgacgacgagcacccttac
ctgcccaagcatattctctacaggcagaaagaacagttcagtgacggcgttggctacaac
tggatcgatggcctcaaatccttcactgaacagcaggtgacggatgagatgatgaacaac
gccgcccagatgttcccctacaacacgcccgtcaacaaggaggcctactactaccggatg
atattcgagaggctcttccctcaggactcggcgagggagacggtgccgtggggcccgagc
atcgcctgcagcacgcccgcggccatcgagtgggtggagcagtggaaggcctccaacgac
ccctccggccgcttcatctcctcccacgactccgccgccaccgaccacacggcggtaagc
cggcggtggccaacggcggcggcacggccggcgaacggcacggtcaacggcaaggacgtg
ccagtgccgatcgcggtctga

DBGET integrated database retrieval system