KEGG   Zea mays (maize): 542492Help
Entry
542492            CDS       T01088                                 

Gene name
dnp1, DP1, GRMZM2G152757
Definition
(RefSeq) diphosphonucleotide phosphatase 1
  KO
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
zma  Zea mays (maize)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    542492 (dnp1)
  Energy metabolism
   00920 Sulfur metabolism
    542492 (dnp1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    542492 (dnp1)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     542492 (dnp1)
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     542492 (dnp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 414 aa AA seqDB search
MAARVGLLPHAILVSSRALPTPRARVPYPLPPVPSYLRHASSSASRSCRASPRFVAVRAM
ASGNPYAAELAAAKKAVTLAAKLCQTVQQDIMHSGVQAKADKSPVTVADYGSQILVGFSL
KMDVSSGPFSLVAEEDSDELRKDGAEEILEDITDLVNETIFDDGSYNISFTKEGILSAID
DGKSEGGPSGRHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGVLACPNLPLSSINNI
NGNSSGDKVGALFSATIGCGAQVESLDGSPPQKISVCSIDNPVNASFFESYESAHSMHDL
TGSIAEKLGVQAPPVRIDSQAKYGALARGDGAIYLRFPHKGYREKIWDHAAGSIVVTEAG
GIVTDAAGNDLDFSKGRFLDLDTGIIATNKELMPSLLKAVQEAIKETNQAASLL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcgcgtgggcctgctcccgcacgcgatcctcgtctcctcccgagctctaccc
acgccccgagctcgcgtcccttatcctcttccacccgtcccttcctacctccgccacgcc
tcctcctccgcctcccgctcctgccgcgcgtcgccgcgttttgtcgcagtccgcgccatg
gcttcggggaacccctacgccgccgagctcgccgccgccaagaaggccgtcaccctcgcc
gccaaactctgccagacagttcaacaggatattatgcattctggcgttcaggctaaggca
gacaaaagtcctgtcacagtggctgattatggatctcaaatattggtcggtttttcctta
aagatggatgtatcatctggaccattttcattggtggctgaagaggactcagatgaattg
agaaaagatggcgctgaagaaattttggaagatattactgaccttgtcaatgaaaccatc
tttgatgatggttcatataacatttcgtttacaaaggaaggtatactctctgcaattgat
gatgggaagtctgagggaggtccatctggacgacattgggtgcttgatccgattgacggt
actaaaggtttcttgaggggcgaccaatatgccattgcattggctctgcttgatgaaggt
aaagttgttttgggtgtattggcttgtccaaatcttccattgtcatcaataaacaacatc
aatggtaactcttcgggagataaagttggtgccctgttttctgctacaattggttgtggg
gctcaagtagagtccttagatggctctccaccacaaaagattagtgtttgctccatcgac
aatcctgtcaatgcatcattttttgaatcctatgaaagtgcacactccatgcatgatttg
actggctctattgcagagaaacttggtgtccaagctcctccagttagaatcgacagccaa
gcaaaatatggtgctctggcccgaggtgatggcgccatttacttgcgctttccacacaaa
ggttatagagagaaaatatgggaccatgcagcaggatcaattgtcgtgacagaagctgga
ggcatagtaacagatgctgcgggaaacgacttggatttctccaaagggagatttctggat
ctcgacacaggcatcatcgcaaccaacaaggagttgatgccgtcgctcctgaaagctgtc
caagaggctattaaagagacgaaccaggctgcctccctcttatag

DBGET integrated database retrieval system