KEGG   Zea mays (maize): 542492Help
Entry
542492            CDS       T01088                                 

Gene name
dnp1, DP1
Definition
diphosphonucleotide phosphatase1
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
zma  Zea mays (maize)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:zma00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:zma00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:zma04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 355 aa AA seqDB search
MASGNPYAAELAAAKKAVTLAAKLCQTVQQDIMHSGVQAKADKSPVTVADYGSQILVGFS
LKMDVSSGPFSLVAEEALDELRKDGAEEILEDITDLVNETIFDDGSYNISFTKEGILSAI
DDGKSEGGPSGRHWVLDPIDGTKGFLRGDQYAIALALLDEGKVVLGVLACPNLPLSSINN
INGNSSGDKVGALFSATIGCGAQVESLDGSPPQKISVCSIDNPVNASFFESYESAHSMHD
LTRSIAEKLGVQAPPVRIDSQAKYGALARGDGAIYLRFPHKGYREKIWDHAGGSIVVTEA
GGIVTDAAGKDLDFSKGRFLDLDTGIIATNKELMPSLLKAVQEAIKETNQAASLL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggggaacccctacgccgccgagctcgccgccgccaagaaggccgtcaccctc
gccgccaaactctgccagacagttcaacaggatattatgcattctggcgttcaggctaag
gcagacaaaagtcctgtcacagtggctgattatggatctcaaatattggtcggtttttcc
ttaaagatggatgtatcatctggaccattttcattggtggctgaagaggcactagatgaa
ttgagaaaagatggcgctgaagaaattttggaagatattactgaccttgtcaatgaaacc
atctttgatgatggttcatataacatttcgtttacaaaggaaggtatactctctgcaatt
gatgatgggaagtctgagggaggtccatctggacgacattgggtgcttgatccgattgac
ggtactaaaggtttcttgaggggcgaccaatatgccattgcattggctctgcttgatgaa
ggtaaagttgttttgggtgtattggcttgtccaaatcttccattgtcatcaataaacaac
atcaatggtaactcttcgggagataaagttggtgccctgttttctgctacaattggttgt
ggggctcaagtagagtccttagatggctctccaccacaaaagattagtgtttgctccatc
gacaatcctgtcaatgcatcattttttgaatcctatgaaagtgcacactccatgcatgat
ttgactcgctctattgcagagaaacttggtgtccaagctcctccagttagaatcgacagc
caagcaaaatatggtgctctggcccgaggtgatggcgccatttacttgcgctttccacac
aaaggttatagagagaaaatatgggaccatgcaggaggatcaattgtcgtgacagaagct
ggaggcatagtaacagatgctgcgggaaaggacttggatttctccaaagggagatttctg
gatctcgacacaggcatcatcgcaaccaacaaggagttgatgccgtcgctcctgaaagct
gtccaagaggctattaaagagacgaaccaggctgcctccctcttatag

DBGET integrated database retrieval system