KEGG   Zea mays (maize): 542554Help
Entry
542554            CDS       T01088                                 

Gene name
prpo1
Definition
protoporphyrinogen IX oxidase (plastidic)1
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
zma  Zea mays (maize)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    542554 (prpo1)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     542554 (prpo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 535 aa AA seqDB search
MVAATATAMATAASPLLNGTRIPARLRHRGLSVRCAAVAGGAAEAPASTGARLSADCVVV
GGGISGLCTAQALATRHGVGDVLVTEARARPGGNITTVERPEEGYLWEEGPNSFQPSDPV
LTMAVDSGLKDDLVFGDPNAPRFVLWEGKLRPVPSKPADLPFFDLMSIPGKLRAGLGALG
IRPPPPGREESVEEFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWRLEETG
GSIIGGTIKTIQERSKNPKPPRDARLPKPKGQTVASFRKGLAMLPNAITSSLGSKVKLSW
KLTSITKSDDKGYVLEYETPEGVVSVQAKSVIMTIPSYVASNILRPLSSDAADALSRFYY
PPVAAVTVSYPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPDGRVL
LLNYIGGATNTGIVSKTESELVEAVDRDLRKMLINSTAVDPLVLGVRVWPQAIPQFLVGH
LDLLEAAKAALDRGGYDGLFLGGNYVAGVALGRCVEGAYESASQISDFLTKYAYK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgccacagccaccgccatggccaccgctgcatcgccgctactcaacgggacc
cgaatacctgcgcggctccgccatcgaggactcagcgtgcgctgcgctgctgtggcgggc
ggcgcggccgaggcaccggcatccaccggcgcgcggctgtccgcggactgcgtcgtggtg
ggcggaggcatcagtggcctctgcaccgcgcaggcgctggccacgcggcacggcgtcggg
gacgtgcttgtcacggaggcccgcgcccgccccggcggcaacattaccaccgtcgagcgc
cccgaggaagggtacctctgggaggagggtcccaacagcttccagccctccgaccccgtt
ctcaccatggccgtggacagcggactgaaggatgacttggtttttggggacccaaacgcg
ccgcgtttcgtgctgtgggaggggaagctgaggcccgtgccatccaagcccgccgacctc
ccgttcttcgatctcatgagcatcccagggaagctcagggccggtctaggcgcgcttggc
atccgcccgcctcctccaggccgcgaagagtcagtggaggagttcgtgcgccgcaacctc
ggtgctgaggtctttgagcgcctcattgagcctttctgctcaggtgtctatgctggtgat
ccttctaagctcagcatgaaggctgcatttgggaaggtttggcggttggaagaaactgga
ggtagtattattggtggaaccatcaagacaattcaggagaggagcaagaatccaaaacca
ccgagggatgcccgccttccgaagccaaaagggcagacagttgcatctttcaggaagggt
cttgccatgcttccaaatgccattacatccagcttgggtagtaaagtcaaactatcatgg
aaactcacgagcattacaaaatcagatgacaagggatatgttttggagtatgaaacgcca
gaaggggttgtttcggtgcaggctaaaagtgttatcatgactattccatcatatgttgct
agcaacattttgcgtccactttcaagcgatgctgcagatgctctatcaagattctattat
ccaccggttgctgctgtaactgtttcgtatccaaaggaagcaattagaaaagaatgctta
attgatggggaactccagggctttggccagttgcatccacgtagtcaaggagttgagaca
ttaggaacaatatacagttcctcactctttccaaatcgtgctcctgacggtagggtgtta
cttctaaactacataggaggtgctacaaacacaggaattgtttccaagactgaaagtgag
ctggtcgaagcagttgaccgtgacctccgaaaaatgcttataaattctacagcagtggac
cctttagtccttggtgttcgagtttggccacaagccatacctcagttcctggtaggacat
cttgatcttctggaagccgcaaaagctgccctggaccgaggtggctacgatgggctgttc
ctaggagggaactatgttgcaggagttgccctgggcagatgcgttgagggcgcgtatgaa
agtgcctcgcaaatatctgacttcttgaccaagtatgcctacaagtga

DBGET integrated database retrieval system