KEGG   Zea mays (maize): 542568Help
Entry
542568            CDS       T01088                                 

Gene name
cl3393_1, hda113
Definition
LOC542568
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     542568 (cl3393_1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 476 aa AA seqDB search
MSLGYAEKLSYREDVGTVGMPEIFETPELVQNKIEELAAMVQKSKHLVVFTGAGISTSSG
IPDFRGPMGVWTLQRAGKGIPNASLPFHHAVPSLTHMALVELERAGFLKFVISQNVDSLH
LRSGFPREKLAELHGNSFKEICPCCKTEYLRDFEIETIGLKDTPRRCSDKNCGARLKDTV
LDWDDALPPEEMNLATEHCRSADLVLCLGTSLQITPACNMPLMSIKNGGRVAIVNLQATP
KDKKASLVIHGLVDKVIAGVMSKLSLRIPPYIRTDFVQLTLRHSLKKKCVRWTLRVTSIH
GLRAPLPFLQSVKVSFPERPDLKSVVLKEQPFSLQRETSMNKPFFMLLTLNFSDGCSCLS
SSIGWPVDFQKRKDSFVRDRALVLRELYSAAQRESCIGQQEILERENLPRAETSIHGIVT
NIVRYDTEDEKLAPPKNDLMNHSRSNPAKRHVEGTDCHSSLPKKLKYFLKDKKLNC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgggctatgctgagaagctgtcctaccgggaggatgtgggtactgtgggaatg
cctgagatctttgagacccctgagctagtccagaataagatagaagagcttgctgccatg
gtgcaaaagagtaagcatttagtggtgtttaccggggcagggatatcaacttcatcaggc
atacctgattttcgagggcccatgggtgtctggaccttgcagcgtgcaggaaaaggtatt
cctaatgcatcacttcccttccatcatgctgttccaagcttgacacatatggcactagtc
gaacttgaaagagcaggatttctaaagtttgtcataagccagaatgttgacagcctacat
ctccgttctggtttcccaagggagaagttggctgaattacatggcaattctttcaaggag
atctgcccatgctgtaaaactgagtaccttcgtgattttgagattgagacaattggactg
aaggatactccaagacgttgttctgataagaattgtggagctagattaaaggatacagtt
cttgactgggatgatgctttaccccctgaggagatgaatttggccacggagcattgtcga
tcagctgatcttgttctatgtctaggaactagtttgcagattactcctgcatgtaatatg
cctctgatgtcaatcaagaatggggggagggtggccattgtaaatcttcaggcaactcca
aaggataaaaaggcaagccttgtcatccatggacttgttgataaggtcattgctggagtc
atgagcaagttgagtctgcgaattcctccatacatacgtactgactttgttcagctcact
ctcaggcactcactgaaaaagaaatgtgttagatggactcttcgagtaacaagtattcat
ggcctccgagcaccattgccatttcttcagtctgtcaaggtttcctttccagaaagacct
gatctgaagtctgtagtgcttaaagagcaaccattctctttgcagagggaaacatcgatg
aacaaaccatttttcatgctgttgacattaaatttcagtgatggttgcagctgtttgagc
tcctcaattggatggcctgttgattttcagaagcgaaaagacagcttcgtcagagataga
gctctagtcctacgggagttgtactctgctgcacagcgcgagtcttgcattgggcaacaa
gaaattctggaaagagagaacctaccaagagctgagacgtctattcatggaatcgtgaca
aacatcgttaggtatgacactgaagatgaaaagttggctccacccaagaatgatttgatg
aatcacagccgcagcaaccctgcaaaacggcacgtggaaggcactgattgccactcgtca
ttgccaaagaaactgaagtactttttgaaagacaagaagctgaactgctaa

DBGET integrated database retrieval system