KEGG   Zea mays (maize): 542590Help
Entry
542590            CDS       T01088                                 

Gene name
mn1
Definition
(RefSeq) miniature seed 1 precursor
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
zma  Zea mays (maize)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    542590 (mn1)
   00500 Starch and sucrose metabolism
    542590 (mn1)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     542590 (mn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 593 aa AA seqDB search
MRALVVVSFASACLLLLLQLAGASHVVYNYKDLEAEAAAATDQVPPSIVNPLLRTGYHFQ
PPKNWINDPNAPMYYKGWYHFFYQYNPKGAVWGNIVWAHSVSRDLINWVALEPALRPSIP
GDRYGCWSGSATVLPDGGGPVIMYTGVDHPDINYQVQNVAYPKNVSDPLLREWVKPSHNP
VIVPEGGINATQFRDPTTAWRGPGPEQWRLLVGSAAGSSPRGVAYVYRSRDFRRWRRVRR
PLHSAATGMWECPDFYPVSKGGAPRAGLETSVPPGPRVKHVLKNSLDLRRYDYYTVGTYH
PRAERYVPDDPAGDEHRLRYDYGNFYASKTFYDPAKRRRILWGWANESDSAADDVAKGWA
GIQAIPRTVWLDPSGKQLLQWPIEEVEALREKSVTLKNRLIKAGHHVEVTGIQTAQADVE
VSFEVSPAALAGAETLDPALAYDAEKLCGVKRADVRGGVGPFGLWVLASANRKERTAVFF
RVFKPAAGSDKPVVLMCTDPTKSSLNPNLYRPTFAGFVDTDISNGKISLRSLIDRSVVES
FGAGGKTCILSRVYPSLAIGKDARLYVFNNGRAHVKVSRLTAWEMKKPVMNGA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagagccctcgtagtcgtaagtttcgcttcggcgtgcttgctgctgctgttgcagctc
gcaggagcgtcgcatgtcgtctacaactacaaggacctcgaagccgaggctgctgcggcg
acggaccaggtgccgccgtccatcgtcaaccccctgctcaggacggggtaccacttccag
ccccccaagaactggatcaatgatcccaacgcgcccatgtactacaaggggtggtaccat
ttcttctaccaatacaatcccaagggcgccgtatggggcaacatcgtgtgggcgcactcg
gtgtcgcgagacctcatcaactgggtggcgctagagccggcgctcagaccaagcatcccg
ggcgacaggtacggctgctggtccgggtcggcgacggtgctgcccgacggcggcggcccg
gtgatcatgtacacgggcgtggaccacccggacatcaactaccaggtccagaacgtggcg
tacccgaagaacgtgtcggacccgctgctccgggagtgggtgaagccctcgcacaacccc
gtcatcgtccccgagggcggcatcaacgcgacgcagttccgcgacccgaccacggcctgg
cgcggccccggccccgagcagtggcggctgctcgtgggcagcgcggcggggtcgtcgccc
cgcggcgtggcgtacgtgtaccgcagccgcgacttccggcggtggaggcgggtgcggcgg
ccgctgcactcggcggccacggggatgtgggagtgccccgacttctacccggtgagcaag
ggcggcgcgccgcgcgcggggctcgagacgtccgtgccgcccggcccaagggtgaagcac
gtgctcaagaacagcctcgacctccggcggtacgactactacaccgtgggcacgtaccac
ccgagggccgagcggtacgtgccggacgaccccgccggcgacgagcaccgcctgcgctac
gactacggcaacttctacgcgtccaagacgttctacgacccggccaagcggcgccgcatc
ctgtggggctgggctaacgagtccgactccgccgccgacgatgtggccaaaggctgggct
ggaatccaggcgattccaaggacggtgtggctggaccccagcgggaagcagctgctgcag
tggcctatcgaggaggtggaggcgctgagagaaaagtcggtcactctcaagaacaggtta
atcaaggcaggacatcacgtcgaggtgaccgggatacaaacggcacaggctgacgtggag
gtgagcttcgaggtgtcgccggcggccctggccggtgccgagacgctggacccggcgctg
gcctacgacgcggagaagctgtgcggcgtgaagcgcgcggacgtgaggggcggcgtgggg
ccgttcgggctgtgggtgctggcctccgccaaccgcaaggagagaaccgccgtgttcttc
agggtgttcaagcccgccgccggcagcgacaagcccgtggtgctcatgtgcaccgaccct
accaagtcgtccctgaacccgaacctgtaccgcccgacatttgcaggatttgtcgacacg
gacatctcgaacggcaagatatccctgagaagcctgatcgaccggtcggtcgttgagagc
ttcggagccgggggcaagacctgcatcctctccagggtctacccgtcgctggccatcggc
aaggacgctcgcctctacgtgttcaacaacgggagggcgcacgtcaaggtgtcccgtctc
accgcgtgggagatgaagaagccggtcatgaacggggcctga

DBGET integrated database retrieval system