KEGG   Zea mays (maize): 542594Help
Entry
542594            CDS       T01088                                 

Gene name
gpm355, MPK4, ZmMPK4
Definition
LOC542594
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     542594 (gpm355)
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   542594 (gpm355)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   542594 (gpm355)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 406 aa AA seqDB search
MSSVGGMDGSPPVAEFQPTVTHGGRFLRYNIFGNLFEITRKYQPPVMPIGRGAYGIVCSV
MNFETREMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENIIGIRDVIPPPVPQAFNDV
YIGTELMDTDLHHIIRSNQELSEEHSQYFLYQILRGLKYIHSANVIHVDLKPSNLLVNAN
CDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINR
QPLFPGRDHMHQMRLITEARVTHATHPTSPSYNSIPSSSSAHNIAARQVIGTPTDDELGF
IRNEDARKYMRHLPQFPRRPFVSLFPRMQPVALDLIERMLTFNPLQRITVEEALEHPYLE
RLHDVADEPICTDPFSFDFEQQALTEDQMKQLIFNEAIELNPNFRY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgtcggaggcatggacgggtctccgccggtcgccgaattccagccgacggtg
acgcacggcggccggttcctccggtacaatatcttcggcaacctgttcgagatcacgcgc
aagtaccagcctcccgtcatgcccatcggccgcggcgcctacgggatcgtctgctcggtg
atgaacttcgagacgagggagatggtggccatcaagaagatcgccaacgccttcgacaac
cacatggacgccaagcgcacgctccgggagatcaagctgctaaggcacctcgaccacgag
aacatcatcggcatcagggacgtgatcccgccgcccgtcccgcaggcgttcaacgacgtg
tacatcgggacggagctgatggacacggacctgcaccacatcatccggtccaaccaggag
ctctcggaggagcactcccagtacttcctgtaccagatcctccgcgggctcaagtacatc
cactccgccaacgtgatccacgttgacctcaagcccagcaacctgctggtgaacgccaac
tgcgacctcaagatctgcgacttcgggctggcgcgcccgtcctccgagagcgacatgatg
acggagtacgtggtcacgcgctggtaccgcgcgcccgagctgctgctcaactccaccgac
tactcggcggccatcgacgtctggtccgtcggctgcatcttcatggagctcatcaaccgc
cagccgctcttccccggacgcgaccacatgcaccagatgcgcctcataacagaggcacga
gtgacgcacgcaacgcaccccacatccccttcctataattcaattccttcttcttcttct
gctcataacatcgcggcacggcaggtgatcgggacgcccacggacgatgagctcgggttc
atccggaacgaggacgcgcggaagtacatgcgccacctcccgcagttcccgcgccggccg
ttcgtcagcctgttcccgcggatgcagcccgtcgcgctggacctcatcgagcggatgctc
accttcaacccgctgcagaggatcacagtggaagaggcgctggagcacccgtacctggaa
cggctacacgacgtcgccgacgagcccatctgcacggacccgttctcgttcgacttcgag
cagcaggctctgacggaagaccaaatgaagcagctgatattcaacgaggccatcgaactc
aaccccaacttccgatactag

DBGET integrated database retrieval system