KEGG   Zea mays (maize): 542603Help
Entry
542603            CDS       T01088                                 

Gene name
pdlk2, PDK2
Definition
pyruvate dehydrogenase (lipoamide) kinase2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     542603 (pdlk2)
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   542603 (pdlk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
7
AA seq 364 aa AA seqDB search
MASEPVARAVAEEVGRWGSMKQTGVTLRYMMEFGSRPTQRNLLLSAQFLHKELPIRFARR
ALELDSLPFGLSNKPAILKVRDWYLDSFRDIRYFPEVRSRNDELAFTQMINMVKVRHNNV
VPTMALGVQQLKKELGRSRKVPFEFDEIDEFLDRFYMSRIGIRMLIGQHVALHDPKPEPG
VIGLINTRLSPIQVAQAACEDARSVCLREYGSAPDINIYGDPNFTFPYVTLHLHLMLFEL
VKNSLRAVQERYMNSDKDVPPVRIIVADGEEDVTIKVSDEGGGIPRSGLPRIFTYLYSTA
KNPPELDRPNTERVTMAGYGFGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSE
EPLP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggagccggtggcgcgggcggtggcggaggaggtgggccgctggggcagcatg
aagcagacgggggtgaccctgcggtacatgatggagttcggctcccgccccacccagcgc
aacctgctcctctccgcgcagttcctgcacaaggagctccccatccgcttcgcgcgccgc
gcgctcgagctcgactcgctgcccttcggcctctccaacaagcccgccatcctcaaggtg
cgggactggtacttggactcattccgggacatcagatacttccctgaagtgaggagccgg
aacgacgagctcgctttcacgcagatgatcaatatggtcaaggtgcggcataacaatgtg
gttccaaccatggccttgggagtgcagcagctgaagaaggagctgggccgctcaaggaag
gttccattcgagttcgatgagatcgacgagttccttgaccggttctacatgtcaaggatt
ggcatccgcatgctgatagggcagcatgtggctttgcatgaccctaaaccggagcctggt
gttataggcctcatcaatacaagattatccccaatccaggtggctcaagctgcttgtgaa
gatgcccgttctgtctgtttaagggaatatggatcagctcctgatattaacatttatggc
gatccaaattttacgtttccatacgtcacattacacctacacctgatgttatttgaattg
gtgaagaactctctccgcgcggtgcaagaacggtatatgaactctgataaagatgttccc
ccggttagaattatagttgctgatggagaagaggatgttactatcaaggttagcgatgaa
ggtggcgggataccaagaagcggcctcccgagaattttcacgtatctgtacagcaccgca
aagaatcctcctgagctagatagacctaatactgaaagggtaactatggctgggtatggt
ttcgggctcccgatcagccgactctacgctcggtattttggcggcgacctgcaaatcatc
tcgatggaaggatacggtaccgatgcttacctccacttgtcgcggctgggagattcagag
gagcccttgccttga

DBGET integrated database retrieval system