KEGG   Zea mays (maize): 542625Help
Entry
542625            CDS       T01088                                 

Gene name
prf5
Definition
(RefSeq) profilin-5
  KO
K05759  
profilin
Organism
zma  Zea mays (maize)
Brite
Membrane trafficking [BR:zma04131]
 Others
  Actin-binding proteins
   Others
    542625 (prf5)
Cytoskeleton proteins [BR:zma04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     542625 (prf5)
Exosome [BR:zma04147]
 Exosomal proteins
  Proteins found in most exosomes
   542625 (prf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
9
AA seq 131 aa AA seqDB search
MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL
APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE
RLGDYLIEQGF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcgtacgtcgatgaccacctgctgtgcgacatcgaaggccagcacctc
agcgccgccgccatcgtcggccacgacggcagcgtctgggcacagtccgagaacttcccc
gagttaaagcctgaggaggttgctgggatgataaaggactttgatgaacctggaactctt
gcaccaactggtctttttgttggaggtacgaagtacatggtgatccaaggtgaacctgga
gttgtcatccgaggaaagaagggcactggaggcattactatcaagaaaactggcatgtcc
ttgattatcggtatctatgatgagccaatgactccagggcaatgcaatatggtggtggag
aggctcggcgattacctgatcgaacagggcttctaa

DBGET integrated database retrieval system