KEGG   Zea mays (maize): 542662Help
Entry
542662            CDS       T01088                                 

Gene name
sdg110a, sdg110
Definition
LOC542662
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
zma  Zea mays (maize)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    542662 (sdg110a)
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     542662 (sdg110a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 342 aa AA seqDB search
MVRMSSSSSASGVNLTEQIENVFDQLISKIEQADPDFDPRPFLKQLNVLGRYEPIKRNVY
FTKRYIEDYGISCHCKPSPGSSVVCGRDCYCSMLFSCCSSQCECDIACTNKSFQHRPLTK
TKLIKTEKCGHGLVAEDEIKKGEFVIEYVGEVIDDRTCENRLWTMKRLDDTDFYLCEVSS
NMVIDATNKGNLSRFINHSCEPNTAMQKWTVDGETRVGIFALRDIKIGEELTYDYKFVQF
GAAQVCHCGSSKCRKMLGTTKYSGSSQNHRTKKKKRKTSCENCIQQFLRLWHPRQKMYVG
CWIVDFDQGTKMHTLQFIDHHTEKFDLKEEEWHFLEVDSDED
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtccgtatgagctcatcttcctcggcgtctggggtcaatctgacagagcaaatcgag
aatgtttttgaccaactgatcagcaaaattgaacaagcggatccagattttgacccgcgg
ccctttttgaaacaattgaatgtgttaggccgctatgaaccaatcaagcggaatgtatat
ttcactaagagatacattgaagattatggcatttcttgtcactgtaagccttctcctggt
tcatcagttgtgtgtggcagagactgctattgtagcatgcttttctcttgctgttcatca
caatgtgaatgtgatattgcgtgcaccaataaatcattccagcacagacctcttacgaaa
accaaattgattaagacagagaaatgtggtcatggattggttgctgaggatgaaataaag
aaaggagaatttgttattgagtatgttggagaagttattgatgacagaacatgtgagaat
aggctatggacaatgaaaaggctggatgacactgacttctacctttgtgaggtcagcagt
aatatggtcattgatgcaacaaacaagggaaacctgtcccgatttataaaccatagttgt
gaaccaaacacagcgatgcagaaatggactgttgatggagagaccagggttggaattttt
gcacttcgtgacataaagataggggaggagctgacatatgactataaatttgtccagttt
ggagcagctcaggtttgtcattgtggatcttcaaagtgcagaaaaatgctaggcacaaca
aagtattcaggaagctcacagaatcatcgtaccaagaagaaaaagaggaaaacaagttgt
gagaattgcatacagcagtttcttcgtctgtggcatccacgacaaaaaatgtatgttgga
tgttggatagttgacttcgatcaaggaactaaaatgcatactctccagttcattgatcac
catactgaaaagtttgatttgaaagaagaagaatggcacttcttggaggtcgactctgat
gaagattga

DBGET integrated database retrieval system