KEGG   Zea mays (maize): 542687Help
Entry
542687            CDS       T01088                                 

Gene name
SnrK1
Definition
SNF1-related protein kinase
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
zma  Zea mays (maize)
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:zma04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 509 aa AA seqDB search
MDGSSKGSGHSEALRNYNLGRTLGIGTFGKVKIAEHKLTGHRVAIKIINCRQMRNMEMEE
KAKREFKILKLFIHPHIIRLYEVIYTPTDIYVVMEYCKYGELFDYIVEKGRLQEDEARRI
FQQIISGVEYCHRNMVVHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNY
AAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSA
LARDLIPRMLVVEPMKRITIREIREHQWFQIRLPRYLAVPPPDTTQQAKMIDEDTLRDVV
NMGFNKNHVCESLCSRLQNEATVAYYLLLDNRFRATSGYLGADYQESMDRNLNQLASSES
SSSGTRNYVPGSSDPHSSGLRPYYPVERKWALGLQSRAHPREIMVEVLKALQELNVRWKK
NGHYNVKCRWCPGFPEVNDTLDASNSFLGDSTIMDNDDANGRLPTVIKFEFQLYKTKDDK
YLLDMQRVTGPQLLFLDFCAAFLTKLRVL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggatggaagtagtaaagggagtgggcattctgaagcattaaggaactacaacctggga
agaactttaggtatcggtacatttggaaaagtgaagattgcagagcataagcttactgga
catagggttgctataaagatcatcaactgccgccaaatgagaaatatggaaatggaagag
aaagcaaagagagaattcaagatattgaagttgttcattcacccccatatcattcggctt
tatgaggtcatatacacacctacagatatatatgttgtgatggaatattgtaagtatggc
gagttatttgattacattgttgagaaaggcagattacaggaagatgaagctcgtcgaatc
ttccagcagatcatatctggcgtcgaatactgccatagaaacatggttgtccaccgtgac
ctaaagccggaaaacttgttacttgattcaaagtataatgtaaaacttgcggattttggt
ctgagcaatgtcatgcatgatggccattttctgaagactagctgtgggagtccgaactat
gctgctccagaggtaatatctggtaaactatatgctggacctgaggtcgatgtatggagt
tgtggggtgattctttatgctcttctttgtggaactcttccatttgatgatgagaatatt
cccaatctgttcaaaaaaattaagggaggtatctacacacttccaagtcatttgtctgct
ttggccagggatttgatcccacgaatgcttgttgttgagcctatgaagagaatcacaatt
agggaaattcgggagcatcaatggttccagattcgccttccacgttacttggcagtgcct
ccaccagatacgacacaacaagccaaaatgattgatgaagatacacttcgagatgttgtt
aatatgggatttaacaagaaccatgtgtgtgaatcactgtgcagcagacttcaaaatgag
gcaactgttgcatattatttactattggacaatcggtttagagcaactagtggctatctt
ggggcagattatcaagaatcaatggacaggaatttaaatcagctggcgtcatctgaatca
tctagttctggtacgaggaattatgttccaggaagcagtgatcctcatagcagtggtttg
cggccatattatcctgttgaaagaaaatgggcgcttggacttcagtctcgggcccaccct
cgtgaaataatggttgaggtcttaaaagcacttcaagaattaaacgtcagatggaagaag
aatgggcactacaacgtgaaatgcagatggtgcccagggtttcctgaagttaatgacacg
ttagatgccagcaacagctttcttggtgactctaccatcatggataatgatgatgctaat
gggaggctacctactgtgatcaagtttgaattccagctttacaagacgaaggacgacaag
tacctcttagatatgcagagagttactggacctcagctgctcttccttgacttctgtgcg
gccttccttaccaagcttagggttctatag

DBGET integrated database retrieval system