KEGG   Zea mays (maize): 542687Help
Entry
542687            CDS       T01088                                 

Gene name
SnrK1
Definition
SNF1-related protein kinase
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
zma  Zea mays (maize)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:zma00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    542687 (SnrK1)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     542687 (SnrK1)
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   542687 (SnrK1)
Mitochondrial biogenesis [BR:zma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    542687 (SnrK1)
  Mitophagy factors
   Other mitophagy factors
    542687 (SnrK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 509 aa AA seqDB search
MDGSSKGSGHSEALRNYNLGRTLGIGTFGKVKIAEHKLTGHRVAIKIINCRQMRNMEMEE
KAKREFKILKLFIHPHIIRLYEVIYTPTDIYVVMEYCKYGELFDYIVEKGRLQEDEARRI
FQQIISGVEYCHRNMVVHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNY
AAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSA
LARDLIPRMLVVEPMKRITIREIREHQWFQIRLPRYLAVPPPDTTQQAKMIDEDTLRDVV
NMGFNKNHVCESLCSRLQNEATVAYYLLLDNRFRATSGYLGADYQESMDRNLNQLASSES
SSSGTRNYVPGSSDPHSSGLRPYYPVERKWALGLQSRAHPREIMVEVLKALQELNVRWKK
NGHYNVKCRWCPGFPEVNDTLDASNSFLGDSTIMDNDDANGRLPTVIKFEFQLYKTKDDK
YLLDMQRVTGPQLLFLDFCAAFLTKLRVL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggatggaagtagtaaagggagtgggcattctgaagcattaaggaactacaacctggga
agaactttaggtatcggtacatttggaaaagtgaagattgcagagcataagcttactgga
catagggttgctataaagatcatcaactgccgccaaatgagaaatatggaaatggaagag
aaagcaaagagagaattcaagatattgaagttgttcattcacccccatatcattcggctt
tatgaggtcatatacacacctacagatatatatgttgtgatggaatattgtaagtatggc
gagttatttgattacattgttgagaaaggcagattacaggaagatgaagctcgtcgaatc
ttccagcagatcatatctggcgtcgaatactgccatagaaacatggttgtccaccgtgac
ctaaagccggaaaacttgttacttgattcaaagtataatgtaaaacttgcggattttggt
ctgagcaatgtcatgcatgatggccattttctgaagactagctgtgggagtccgaactat
gctgctccagaggtaatatctggtaaactatatgctggacctgaggtcgatgtatggagt
tgtggggtgattctttatgctcttctttgtggaactcttccatttgatgatgagaatatt
cccaatctgttcaaaaaaattaagggaggtatctacacacttccaagtcatttgtctgct
ttggccagggatttgatcccacgaatgcttgttgttgagcctatgaagagaatcacaatt
agggaaattcgggagcatcaatggttccagattcgccttccacgttacttggcagtgcct
ccaccagatacgacacaacaagccaaaatgattgatgaagatacacttcgagatgttgtt
aatatgggatttaacaagaaccatgtgtgtgaatcactgtgcagcagacttcaaaatgag
gcaactgttgcatattatttactattggacaatcggtttagagcaactagtggctatctt
ggggcagattatcaagaatcaatggacaggaatttaaatcagctggcgtcatctgaatca
tctagttctggtacgaggaattatgttccaggaagcagtgatcctcatagcagtggtttg
cggccatattatcctgttgaaagaaaatgggcgcttggacttcagtctcgggcccaccct
cgtgaaataatggttgaggtcttaaaagcacttcaagaattaaacgtcagatggaagaag
aatgggcactacaacgtgaaatgcagatggtgcccagggtttcctgaagttaatgacacg
ttagatgccagcaacagctttcttggtgactctaccatcatggataatgatgatgctaat
gggaggctacctactgtgatcaagtttgaattccagctttacaagacgaaggacgacaag
tacctcttagatatgcagagagttactggacctcagctgctcttccttgacttctgtgcg
gccttccttaccaagcttagggttctatag

DBGET integrated database retrieval system