KEGG   Zea mays (maize): 606409Help
Entry
606409            CDS       T01088                                 

Gene name
PDIL1-1
Definition
protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
zma  Zea mays (maize)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    606409 (PDIL1-1)
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     606409 (PDIL1-1)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   606409 (PDIL1-1)
  Exosomal proteins of colorectal cancer cells
   606409 (PDIL1-1)
  Exosomal proteins of bladder cancer cells
   606409 (PDIL1-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 514 aa AA seqDB search
MAIRSKAWISLLLALAVALSARAEEEPAAAAEGEAVLTLDVDSFDEAVAKHPFMVVEFYA
PWCGHCKKLAPEYENAAKALSKHDPPIVLAKVDANEEKNRPLATKYEIQGFPTIKIFRDQ
GKNIQEYKGPREADGIVDYLKKQVGPASKEIKSPEDATALIDDKKIYIVGIFAEFSGTEF
TNFMEVAEKLRSDYDFGHTLHANHLPRGDAAVERPLVRLLKPFDELVVDSKDFDVAALMK
FIDASTIPRVVTFDKNPDNHPYLMKFFQSSAPKAMLFLNFSTGPFDSFKSAYSAAAEEFK
DKEIKFLIGDIEASQGAFQYFGLKEDQTPLILIQDGDSKKFLKVHVEADQIVAWLKEYFD
GKLTPFRKSEPIPEVNNEPVKVVVADNVHDFVFKSGKNVLIEFYAPWCGHCKKLAPILDE
AATTLQSDEEVVIAKMDATANDVPSEFDVQGYPTLYFVTPSGKVTSYDSGRTADDIVDFI
KKSKETAGAATTTTTQAPPASEKAAAAEPVKDEL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgatccgctccaaggcctggatctcgctgctgctcgcgctggccgtcgcgctctcc
gcccgggcggaggaggagcccgccgccgcggcggagggcgaggccgtgctcaccctcgac
gtcgacagcttcgacgaggccgtcgccaagcaccccttcatggtcgtcgagttctacgcc
ccctggtgtgggcactgcaagaaacttgctccagagtatgagaatgcggccaaggcactt
agcaagcatgacccaccgattgttctcgctaaggttgatgctaacgaggagaagaacagg
ccgcttgctaccaagtacgagatccaagggttcccaaccatcaagatcttcagggaccag
gggaagaacattcaggaatacaagggccctagggaggctgatggcattgtggattacttg
aagaagcaggttggccctgcgtccaaggagatcaagtcaccagaagatgcgacggccctt
atcgatgacaagaagatctacattgttggtatcttcgctgaattcagcggcaccgaattt
acaaacttcatggaggtcgcagagaagctgaggtctgactacgactttggccacactttg
catgccaaccacctcccacgtggtgatgcagcagtggaacggccattggtcaggctgctg
aagccatttgatgagcttgttgttgacagcaaggattttgatgtcgctgcactgatgaag
tttattgatgctagcaccatccctagagttgtcacttttgacaagaaccctgacaaccac
ccatacctcatgaaattcttccaaagctcagcccccaaggctatgctgtttttgaacttc
tccaccggaccttttgattctttcaagtctgcctactctgctgccgcggaggaattcaag
gacaaggaaatcaagttccttattggtgacatcgaagccagccagggtgccttccagtac
tttggcctgaaagaggaccagacaccccttatcctcatccaggatggtgactccaagaag
ttcttgaaggttcacgttgaggctgaccagatcgtcgcttggttgaaggagtactttgac
ggcaaattgacgccgttcaggaagtctgagcctattcctgaggtcaacaatgagcctgtt
aaggtggttgtcgctgacaacgtccacgacttcgtcttcaaatctggcaaaaatgtcctt
attgaattctatgccccctggtgcggacactgcaagaagctggcgcccatcttggacgag
gcagccaccactctccagagcgacgaggaagtcgtgattgctaagatggacgcgactgcc
aatgacgttcccagtgagtttgacgtccaaggctacccgaccttgtacttcgtgaccccg
agcgggaaggtgacatcctacgacagcggcaggacggcggacgacatcgtcgacttcatc
aagaagagcaaggagaccgcaggcgccgccaccaccaccaccacccaggcgccaccggca
tccgagaaggcagccgccgccgagcccgtcaaggacgagctgtga

DBGET integrated database retrieval system